Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4999
Gene name
LocationContig_36:84306..85793
Strand-
Gene length (bp)1487
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 5.8E-27 13 233
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.1E-14 15 241
PF17667 Pkinase_fungal Fungal protein kinase 4.5E-07 121 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40233|CKI1_SCHPO Casein kinase I homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki1 PE=1 SV=2 3 359 0.0E+00
sp|P40234|CKI2_SCHPO Casein kinase I homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki2 PE=1 SV=2 3 313 0.0E+00
sp|O74135|CKI3_SCHPO Casein kinase I homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki3 PE=3 SV=1 2 319 2.0E-172
sp|P40230|RAG8_KLULA Casein kinase I homolog RAG8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG8 PE=3 SV=2 6 308 9.0E-164
sp|P23292|KC12_YEAST Casein kinase I homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK2 PE=1 SV=1 6 308 4.0E-163
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40233|CKI1_SCHPO Casein kinase I homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki1 PE=1 SV=2 3 359 0.0E+00
sp|P40234|CKI2_SCHPO Casein kinase I homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki2 PE=1 SV=2 3 313 0.0E+00
sp|O74135|CKI3_SCHPO Casein kinase I homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki3 PE=3 SV=1 2 319 2.0E-172
sp|P40230|RAG8_KLULA Casein kinase I homolog RAG8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG8 PE=3 SV=2 6 308 9.0E-164
sp|P23292|KC12_YEAST Casein kinase I homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK2 PE=1 SV=1 6 308 4.0E-163
sp|P23291|KC11_YEAST Casein kinase I homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK1 PE=1 SV=1 6 308 3.0E-161
sp|P39962|KC13_YEAST Casein kinase I homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK3 PE=1 SV=2 4 348 8.0E-146
sp|Q8C4X2|KC1G3_MOUSE Casein kinase I isoform gamma-3 OS=Mus musculus GN=Csnk1g3 PE=1 SV=2 8 297 4.0E-134
sp|Q62763|KC1G3_RAT Casein kinase I isoform gamma-3 OS=Rattus norvegicus GN=Csnk1g3 PE=1 SV=1 8 297 5.0E-134
sp|P78368|KC1G2_HUMAN Casein kinase I isoform gamma-2 OS=Homo sapiens GN=CSNK1G2 PE=1 SV=1 2 359 5.0E-134
sp|Q8BVP5|KC1G2_MOUSE Casein kinase I isoform gamma-2 OS=Mus musculus GN=Csnk1g2 PE=1 SV=1 2 359 7.0E-134
sp|Q62762|KC1G2_RAT Casein kinase I isoform gamma-2 OS=Rattus norvegicus GN=Csnk1g2 PE=2 SV=2 2 359 1.0E-133
sp|Q5R4V3|KC1G3_PONAB Casein kinase I isoform gamma-3 OS=Pongo abelii GN=CSNK1G3 PE=2 SV=1 3 297 2.0E-133
sp|Q5PRD4|KC1G1_DANRE Casein kinase I isoform gamma-1 OS=Danio rerio GN=csnk1g1 PE=2 SV=1 8 359 4.0E-132
sp|Q9Y6M4|KC1G3_HUMAN Casein kinase I isoform gamma-3 OS=Homo sapiens GN=CSNK1G3 PE=1 SV=2 3 297 8.0E-132
sp|Q62761|KC1G1_RAT Casein kinase I isoform gamma-1 OS=Rattus norvegicus GN=Csnk1g1 PE=2 SV=1 2 314 9.0E-131
sp|Q8BTH8|KC1G1_MOUSE Casein kinase I isoform gamma-1 OS=Mus musculus GN=Csnk1g1 PE=1 SV=2 2 314 1.0E-130
sp|Q4R9A9|KC1G1_MACFA Casein kinase I isoform gamma-1 OS=Macaca fascicularis GN=CSNK1G1 PE=2 SV=1 8 314 1.0E-130
sp|A7E3X2|KC1G1_BOVIN Casein kinase I isoform gamma-1 OS=Bos taurus GN=CSNK1G1 PE=2 SV=1 3 314 3.0E-130
sp|Q9HCP0|KC1G1_HUMAN Casein kinase I isoform gamma-1 OS=Homo sapiens GN=CSNK1G1 PE=1 SV=1 8 314 5.0E-130
sp|Q5ZJS0|KC1G1_CHICK Casein kinase I isoform gamma-1 OS=Gallus gallus GN=CSNK1G1 PE=2 SV=1 8 297 2.0E-129
sp|Q6NRT0|KC1G1_XENLA Casein kinase I isoform gamma-1 OS=Xenopus laevis GN=csnk1g1 PE=1 SV=1 8 314 8.0E-128
sp|Q8WQ99|KC1G_CAEEL Casein kinase I gamma OS=Caenorhabditis elegans GN=csnk-1 PE=3 SV=1 8 296 7.0E-126
sp|Q6QNM1|KC1_TOXGO Casein kinase I OS=Toxoplasma gondii PE=2 SV=1 9 306 1.0E-120
sp|P67963|KC1A_XENLA Casein kinase I isoform alpha OS=Xenopus laevis GN=csnk1a1 PE=2 SV=1 1 305 6.0E-119
sp|P67962|KC1A_CHICK Casein kinase I isoform alpha OS=Gallus gallus GN=CSNK1A1 PE=2 SV=1 1 305 6.0E-119
sp|P67829|KC1A_SHEEP Casein kinase I isoform alpha OS=Ovis aries GN=CSNK1A1 PE=3 SV=1 1 305 6.0E-119
sp|P67828|KC1A_RABIT Casein kinase I isoform alpha OS=Oryctolagus cuniculus GN=CSNK1A1 PE=1 SV=1 1 305 6.0E-119
sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus GN=CSNK1A1 PE=1 SV=1 1 305 6.0E-119
sp|Q8BK63|KC1A_MOUSE Casein kinase I isoform alpha OS=Mus musculus GN=Csnk1a1 PE=1 SV=2 1 305 6.0E-119
sp|P48729|KC1A_HUMAN Casein kinase I isoform alpha OS=Homo sapiens GN=CSNK1A1 PE=1 SV=2 1 305 6.0E-119
sp|P35509|KC1G3_BOVIN Casein kinase I isoform gamma-3 (Fragment) OS=Bos taurus GN=CSNK1G3 PE=2 SV=1 2 261 7.0E-118
sp|P97633|KC1A_RAT Casein kinase I isoform alpha OS=Rattus norvegicus GN=Csnk1a1 PE=2 SV=1 1 305 9.0E-118
sp|P42158|KC1D_ARATH Casein kinase I isoform delta-like OS=Arabidopsis thaliana GN=At4g26100 PE=2 SV=2 9 426 2.0E-117
sp|Q5BP74|KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis GN=csnk1d PE=1 SV=2 9 296 3.0E-117
sp|Q9JMK2|KC1E_MOUSE Casein kinase I isoform epsilon OS=Mus musculus GN=Csnk1e PE=1 SV=2 9 296 4.0E-117
sp|Q7T2E3|KC1DA_DANRE Casein kinase I isoform delta-A OS=Danio rerio GN=csnk1da PE=2 SV=1 9 388 4.0E-117
sp|P49674|KC1E_HUMAN Casein kinase I isoform epsilon OS=Homo sapiens GN=CSNK1E PE=1 SV=1 9 296 5.0E-117
sp|Q5ZLL1|KC1E_CHICK Casein kinase I isoform epsilon OS=Gallus gallus GN=CSNK1E PE=2 SV=2 9 296 7.0E-117
sp|Q06486|KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2 9 296 8.0E-117
sp|Q9DC28|KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus GN=Csnk1d PE=1 SV=2 9 296 8.0E-117
sp|Q6P647|KC1D_XENTR Casein kinase I isoform delta OS=Xenopus tropicalis GN=csnk1d PE=2 SV=1 9 296 9.0E-117
sp|P48730|KC1D_HUMAN Casein kinase I isoform delta OS=Homo sapiens GN=CSNK1D PE=1 SV=2 9 296 9.0E-117
sp|P35508|KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus GN=CSNK1D PE=2 SV=2 9 296 9.0E-117
sp|Q5RC72|KC1D_PONAB Casein kinase I isoform delta OS=Pongo abelii GN=CSNK1D PE=2 SV=1 9 296 1.0E-116
sp|Q556Y4|KC1_DICDI Casein kinase I OS=Dictyostelium discoideum GN=cak1-1 PE=1 SV=1 9 301 2.0E-116
sp|P40235|HHP1_SCHPO Casein kinase I homolog hhp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp1 PE=2 SV=1 9 296 4.0E-116
sp|Q6P3K7|KC1DB_DANRE Casein kinase I isoform delta-B OS=Danio rerio GN=csnk1db PE=2 SV=1 9 296 5.0E-116
sp|Q6QNL9|KC1_EIMTE Casein kinase I OS=Eimeria tenella PE=2 SV=1 9 296 6.0E-116
sp|P42168|KC1A_CAEEL Casein kinase I isoform alpha OS=Caenorhabditis elegans GN=kin-19 PE=3 SV=1 1 296 3.0E-115
sp|Q8N752|KC1AL_HUMAN Casein kinase I isoform alpha-like OS=Homo sapiens GN=CSNK1A1L PE=2 SV=2 3 305 6.0E-114
sp|Q20471|KIN20_CAEEL Casein kinase I isoform delta OS=Caenorhabditis elegans GN=kin-20 PE=2 SV=3 9 296 4.0E-112
sp|P40236|HHP2_SCHPO Casein kinase I homolog hhp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp2 PE=2 SV=2 9 297 2.0E-111
sp|Q8IHZ9|KC1_PLAF7 Casein kinase I OS=Plasmodium falciparum (isolate 3D7) GN=CK1 PE=3 SV=1 9 299 1.0E-110
sp|Q7RBX5|KC1_PLAYO Casein kinase I OS=Plasmodium yoelii yoelii GN=CK1 PE=3 SV=1 9 299 1.0E-110
sp|P29295|HRR25_YEAST Casein kinase I homolog HRR25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRR25 PE=1 SV=1 9 296 2.0E-110
sp|O76324|DCO_DROME Discs overgrown protein kinase OS=Drosophila melanogaster GN=dco PE=1 SV=2 9 296 1.0E-108
sp|O15726|KC1_PLAF4 Casein kinase I OS=Plasmodium falciparum (isolate Dd2) GN=CK1 PE=2 SV=1 9 299 8.0E-108
sp|P54367|KC1A_DROME Casein kinase I isoform alpha OS=Drosophila melanogaster GN=CkIalpha PE=1 SV=1 8 306 1.0E-105
sp|P35507|KC1B_BOVIN Casein kinase I isoform beta OS=Bos taurus GN=CSNK1B PE=2 SV=1 1 306 1.0E-103
sp|Q8SS96|KC11_ENCCU Probable casein kinase I homolog ECU03_0910 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_0910 PE=3 SV=2 14 297 3.0E-87
sp|Q54DF7|Y2354_DICDI Probable serine/threonine-protein kinase DDB_G0292354 OS=Dictyostelium discoideum GN=DDB_G0292354 PE=3 SV=1 4 304 1.0E-53
sp|Q8SQR2|KC12_ENCCU Probable casein kinase I homolog ECU11_1980 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1980 PE=3 SV=1 13 290 3.0E-45
sp|Q5TCY1|TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens GN=TTBK1 PE=1 SV=2 8 303 2.0E-41
sp|Q6PCN3|TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus GN=Ttbk1 PE=1 SV=3 8 303 3.0E-41
sp|O19175|KC1A_PIG Casein kinase I isoform alpha (Fragment) OS=Sus scrofa GN=CSNK1A1 PE=2 SV=1 37 162 3.0E-41
sp|Q3UVR3|TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus GN=Ttbk2 PE=1 SV=1 8 298 2.0E-40
sp|Q6IQ55|TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens GN=TTBK2 PE=1 SV=2 8 302 2.0E-40
sp|Q32PI1|VRK1_BOVIN Serine/threonine-protein kinase VRK1 OS=Bos taurus GN=VRK1 PE=2 SV=1 13 306 3.0E-33
sp|Q80X41|VRK1_MOUSE Serine/threonine-protein kinase VRK1 OS=Mus musculus GN=Vrk1 PE=1 SV=2 13 305 5.0E-32
sp|P81123|KC1D_RABIT Casein kinase I isoform delta (Fragment) OS=Oryctolagus cuniculus GN=CSNK1D PE=1 SV=1 133 212 7.0E-31
sp|Q95PZ9|SPE6_CAEEL Probable serine/threonine-protein kinase spe-6 OS=Caenorhabditis elegans GN=spe-6 PE=1 SV=1 13 296 1.0E-30
sp|Q99986|VRK1_HUMAN Serine/threonine-protein kinase VRK1 OS=Homo sapiens GN=VRK1 PE=1 SV=1 6 295 1.0E-30
sp|P34516|YMX8_CAEEL Putative serine/threonine-protein kinase K06H7.1 OS=Caenorhabditis elegans GN=K06H7.8 PE=3 SV=2 8 296 3.0E-28
sp|Q7ZUS1|VRK1_DANRE Serine/threonine-protein kinase VRK1 OS=Danio rerio GN=vrk1 PE=2 SV=1 13 296 4.0E-24
sp|Q8BN21|VRK2_MOUSE Serine/threonine-protein kinase VRK2 OS=Mus musculus GN=Vrk2 PE=1 SV=2 7 279 4.0E-22
sp|P16913|VPK1_VACCW Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Western Reserve) GN=VPK1 PE=1 SV=1 13 285 1.0E-21
sp|O57252|VPK1_VACCA Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Ankara) GN=VPK1 PE=3 SV=1 13 285 1.0E-21
sp|P20505|VPK1_VACCC Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Copenhagen) GN=VPK1 PE=2 SV=1 13 285 2.0E-21
sp|P33800|VPK1_VAR67 Serine/threonine-protein kinase 1 OS=Variola virus (isolate Human/India/Ind3/1967) GN=B1R PE=3 SV=1 13 281 3.0E-21
sp|Q7KRY6|NHK1_DROME Nucleosomal histone kinase 1 OS=Drosophila melanogaster GN=ball PE=1 SV=1 12 296 6.0E-21
sp|Q9J523|V212_FOWPN Probable serine/threonine-protein kinase FPV212 OS=Fowlpox virus (strain NVSL) GN=FPV212 PE=3 SV=1 13 279 2.0E-19
sp|Q09503|YQI1_CAEEL Uncharacterized protein C45G9.1 OS=Caenorhabditis elegans GN=C45G9.1 PE=3 SV=2 66 332 4.0E-19
sp|P34633|YOO1_CAEEL Putative serine/threonine-protein kinase ZK507.1 OS=Caenorhabditis elegans GN=ZK507.1 PE=3 SV=3 75 280 3.0E-18
sp|Q86Y07|VRK2_HUMAN Serine/threonine-protein kinase VRK2 OS=Homo sapiens GN=VRK2 PE=1 SV=3 10 279 1.0E-17
sp|P42169|YKL2_CAEEL Putative casein kinase I C03C10.2 OS=Caenorhabditis elegans GN=C03C10.2 PE=3 SV=2 19 223 4.0E-17
sp|Q91FD5|389L_IIV6 Probable serine/threonine-protein kinase 389L OS=Invertebrate iridescent virus 6 GN=IIV6-389L PE=3 SV=1 5 280 6.0E-17
sp|P21098|KRB2_VACCC Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Copenhagen) GN=B12R PE=3 SV=1 68 281 7.0E-17
sp|P24362|KRB2_VACCW Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Western Reserve) GN=VACWR194 PE=2 SV=1 68 281 7.0E-17
sp|O57259|KRB2_VACCA Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Ankara) GN=MVA180R PE=3 SV=1 68 281 2.0E-16
sp|A8WU31|VRK1_CAEBR Serine/threonine-protein kinase VRK1 OS=Caenorhabditis briggsae GN=vrk-1 PE=3 SV=1 13 228 6.0E-16
sp|Q9J509|V226_FOWPN Probable serine/threonine-protein kinase FPV226 OS=Fowlpox virus (strain NVSL) GN=FPV226 PE=3 SV=1 7 278 1.0E-14
sp|P34635|YOO3_CAEEL Putative serine/threonine-protein kinase ZK507.3 OS=Caenorhabditis elegans GN=ZK507.3 PE=3 SV=3 12 306 1.0E-14
sp|Q19848|VRK1_CAEEL Serine/threonine-protein kinase VRK1 OS=Caenorhabditis elegans GN=vrk-1 PE=1 SV=1 13 228 2.0E-14
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 8 221 2.0E-14
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 13 233 3.0E-14
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 13 233 4.0E-14
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 13 233 4.0E-14
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 13 233 4.0E-14
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 13 233 4.0E-14
sp|Q2YDN8|VRK3_BOVIN Inactive serine/threonine-protein kinase VRK3 OS=Bos taurus GN=VRK3 PE=2 SV=1 60 276 8.0E-14
sp|Q8K3G5|VRK3_MOUSE Inactive serine/threonine-protein kinase VRK3 OS=Mus musculus GN=Vrk3 PE=1 SV=2 68 284 1.0E-13
sp|P33973|PKN1_MYXXA Serine/threonine-protein kinase Pkn1 OS=Myxococcus xanthus GN=pkn1 PE=1 SV=1 8 224 1.0E-13
sp|Q8IV63|VRK3_HUMAN Inactive serine/threonine-protein kinase VRK3 OS=Homo sapiens GN=VRK3 PE=1 SV=2 60 276 8.0E-13
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 8 221 1.0E-12
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 2 276 3.0E-12
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 12 230 3.0E-12
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 8 221 5.0E-12
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 13 218 7.0E-12
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 1 221 7.0E-12
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 13 187 9.0E-12
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 10 218 1.0E-11
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 11 219 1.0E-11
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 9 247 1.0E-11
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 11 235 1.0E-11
sp|Q8FUI5|PKN1_COREF Probable serine/threonine-protein kinase CE0033 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0033 PE=3 SV=1 8 221 2.0E-11
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 13 258 2.0E-11
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 13 258 2.0E-11
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 13 221 2.0E-11
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 13 236 3.0E-11
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 13 258 3.0E-11
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 1 218 4.0E-11
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 19 255 4.0E-11
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 13 221 4.0E-11
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 1 218 4.0E-11
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 16 243 4.0E-11
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 11 219 5.0E-11
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 19 221 5.0E-11
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 12 183 5.0E-11
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 9 236 5.0E-11
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 13 236 5.0E-11
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 1 218 6.0E-11
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 12 219 6.0E-11
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 13 161 6.0E-11
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 13 161 6.0E-11
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 9 218 6.0E-11
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 9 218 7.0E-11
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 11 219 8.0E-11
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 13 234 8.0E-11
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 13 228 9.0E-11
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 13 218 9.0E-11
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 13 219 1.0E-10
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 9 274 1.0E-10
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 13 218 1.0E-10
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 13 221 1.0E-10
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 13 271 1.0E-10
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 13 221 1.0E-10
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 17 221 1.0E-10
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 13 221 1.0E-10
sp|Q9XBQ0|PKN3_MYXXA Serine/threonine-protein kinase pkn3 OS=Myxococcus xanthus GN=pkn3 PE=3 SV=1 9 220 2.0E-10
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 13 218 2.0E-10
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 13 228 2.0E-10
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 13 218 2.0E-10
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 13 222 2.0E-10
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 12 217 2.0E-10
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 12 221 2.0E-10
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 13 218 2.0E-10
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 1 218 2.0E-10
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 13 226 2.0E-10
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 19 233 3.0E-10
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 12 221 3.0E-10
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 12 221 3.0E-10
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 13 221 3.0E-10
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 9 222 3.0E-10
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 13 228 3.0E-10
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 2 234 3.0E-10
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 13 228 3.0E-10
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 13 219 3.0E-10
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 13 228 3.0E-10
sp|Q9FGW5|CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana GN=CDKG1 PE=1 SV=1 18 165 4.0E-10
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 12 221 4.0E-10
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 13 238 4.0E-10
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 13 221 4.0E-10
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 12 259 4.0E-10
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 13 183 4.0E-10
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 12 221 5.0E-10
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 3 223 5.0E-10
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 13 219 5.0E-10
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 13 218 5.0E-10
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 12 221 5.0E-10
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 18 219 6.0E-10
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 1 222 6.0E-10
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 13 230 6.0E-10
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 3 220 6.0E-10
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 13 218 6.0E-10
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 13 231 6.0E-10
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 9 185 6.0E-10
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 13 221 6.0E-10
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 13 219 7.0E-10
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 13 226 7.0E-10
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 2 187 7.0E-10
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 13 226 8.0E-10
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 13 226 8.0E-10
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 9 219 8.0E-10
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 17 221 9.0E-10
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 9 218 9.0E-10
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 13 218 9.0E-10
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 17 221 9.0E-10
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 9 219 1.0E-09
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 5 221 1.0E-09
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 12 230 1.0E-09
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 18 219 1.0E-09
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 13 235 1.0E-09
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 13 219 1.0E-09
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 13 218 1.0E-09
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 13 219 2.0E-09
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 13 185 2.0E-09
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 13 219 2.0E-09
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 13 235 2.0E-09
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 13 218 2.0E-09
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 13 219 2.0E-09
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 13 235 2.0E-09
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 18 219 2.0E-09
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 8 240 2.0E-09
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 13 221 2.0E-09
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 13 218 2.0E-09
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 13 219 2.0E-09
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 13 225 2.0E-09
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 13 236 2.0E-09
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 13 218 2.0E-09
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 13 219 3.0E-09
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 13 219 3.0E-09
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 13 219 3.0E-09
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 6 223 3.0E-09
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 19 219 3.0E-09
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 13 218 3.0E-09
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 8 240 3.0E-09
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 8 240 3.0E-09
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 13 261 3.0E-09
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 13 218 3.0E-09
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 13 254 3.0E-09
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 17 185 3.0E-09
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 9 236 3.0E-09
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 13 292 3.0E-09
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 8 240 4.0E-09
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 17 185 4.0E-09
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 13 219 4.0E-09
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 14 219 4.0E-09
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 6 259 4.0E-09
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 13 219 4.0E-09
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 13 221 4.0E-09
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 6 259 4.0E-09
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 6 259 4.0E-09
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 19 219 4.0E-09
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 13 220 5.0E-09
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 13 221 5.0E-09
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 13 219 5.0E-09
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 13 218 5.0E-09
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 8 221 5.0E-09
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 13 219 5.0E-09
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 13 218 5.0E-09
sp|P9WI79|PKND_MYCTU Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknD PE=1 SV=1 13 220 6.0E-09
sp|P9WI78|PKND_MYCTO Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknD PE=1 SV=1 13 220 6.0E-09
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 15 219 6.0E-09
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 12 259 6.0E-09
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 13 185 6.0E-09
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 13 218 6.0E-09
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 13 221 6.0E-09
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 13 234 6.0E-09
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 13 219 6.0E-09
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 19 250 7.0E-09
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 12 221 7.0E-09
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 13 221 7.0E-09
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 6 229 7.0E-09
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 13 235 7.0E-09
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 13 221 8.0E-09
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 13 234 8.0E-09
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 13 221 9.0E-09
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 18 219 9.0E-09
sp|Q07002|CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3 18 185 9.0E-09
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 19 233 9.0E-09
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 12 219 1.0E-08
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 13 234 1.0E-08
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 13 219 1.0E-08
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 10 219 1.0E-08
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 17 234 1.0E-08
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 17 234 1.0E-08
sp|Q5RD01|CDK18_PONAB Cyclin-dependent kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2 18 185 1.0E-08
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 13 219 1.0E-08
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 13 230 1.0E-08
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 18 219 1.0E-08
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 13 219 1.0E-08
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 13 235 1.0E-08
sp|Q9PK92|PKND_CHLMU Serine/threonine-protein kinase PknD OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pknD PE=3 SV=1 13 220 1.0E-08
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 13 219 1.0E-08
sp|G5EBT1|SMA5_CAEEL Mitogen-activated protein kinase sma-5 OS=Caenorhabditis elegans GN=sma-5 PE=2 SV=1 13 170 1.0E-08
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 13 218 1.0E-08
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 18 221 2.0E-08
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 6 219 2.0E-08
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 13 221 2.0E-08
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 18 275 2.0E-08
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 13 241 2.0E-08
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 18 222 2.0E-08
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 11 219 2.0E-08
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 8 226 2.0E-08
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 13 187 2.0E-08
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 13 215 2.0E-08
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 18 275 2.0E-08
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 18 275 2.0E-08
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 13 218 2.0E-08
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 13 238 2.0E-08
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 9 218 2.0E-08
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 13 187 2.0E-08
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 13 215 2.0E-08
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 13 219 2.0E-08
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 17 219 2.0E-08
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 13 219 3.0E-08
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 12 219 3.0E-08
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 9 160 3.0E-08
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 1 234 3.0E-08
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 13 161 3.0E-08
sp|Q7T6Y1|YR436_MIMIV Putative serine/threonine-protein kinase R436 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R436 PE=3 SV=2 12 225 3.0E-08
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 13 219 3.0E-08
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 13 228 3.0E-08
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 12 234 3.0E-08
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 13 187 3.0E-08
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 13 187 3.0E-08
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 19 221 3.0E-08
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 13 219 3.0E-08
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 13 219 3.0E-08
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 13 219 3.0E-08
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 13 187 3.0E-08
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 17 185 3.0E-08
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 9 160 3.0E-08
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 13 231 3.0E-08
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 13 219 3.0E-08
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 13 218 3.0E-08
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 13 228 3.0E-08
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 13 285 3.0E-08
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 13 219 3.0E-08
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 9 160 4.0E-08
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 13 221 4.0E-08
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 9 160 4.0E-08
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 13 230 4.0E-08
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 18 219 4.0E-08
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 17 185 4.0E-08
sp|O60145|PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk23 PE=3 SV=1 13 209 4.0E-08
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 8 224 4.0E-08
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 18 185 4.0E-08
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 1 164 4.0E-08
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 13 219 4.0E-08
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 13 219 4.0E-08
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 12 221 4.0E-08
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 12 221 4.0E-08
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 19 236 5.0E-08
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 13 221 5.0E-08
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 1 220 5.0E-08
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 17 221 5.0E-08
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 18 185 5.0E-08
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 1 222 5.0E-08
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 2 260 5.0E-08
sp|Q4R945|TTK_MACFA Dual specificity protein kinase TTK OS=Macaca fascicularis GN=TTK PE=2 SV=1 1 222 5.0E-08
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 14 222 5.0E-08
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 13 221 5.0E-08
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 13 219 5.0E-08
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 17 264 6.0E-08
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 8 233 6.0E-08
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 13 221 6.0E-08
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 13 187 7.0E-08
sp|B0BBT2|PKND_CHLTB Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=pknD PE=3 SV=1 13 220 7.0E-08
sp|B0B7L7|PKND_CHLT2 Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=pknD PE=3 SV=1 13 220 7.0E-08
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 13 221 7.0E-08
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 13 234 7.0E-08
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 13 219 8.0E-08
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 17 264 8.0E-08
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 13 218 8.0E-08
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 13 218 8.0E-08
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 13 228 8.0E-08
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 19 219 8.0E-08
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 17 218 8.0E-08
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 12 229 8.0E-08
sp|Q3KM61|PKND_CHLTA Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=pknD PE=3 SV=1 13 220 8.0E-08
sp|Q90ZY4|SBK1_DANRE Serine/threonine-protein kinase SBK1 OS=Danio rerio GN=sbk1 PE=1 SV=1 9 253 9.0E-08
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 13 219 9.0E-08
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 7 218 9.0E-08
sp|O84303|PKND_CHLTR Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=pknD PE=1 SV=1 13 220 9.0E-08
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 19 219 9.0E-08
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 13 219 1.0E-07
sp|P42689|SRK3_SPOLA Tyrosine-protein kinase SRK3 (Fragment) OS=Spongilla lacustris GN=SRK3 PE=2 SV=1 17 288 1.0E-07
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 19 236 1.0E-07
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 13 221 1.0E-07
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 19 236 1.0E-07
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 13 218 1.0E-07
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 17 159 1.0E-07
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 13 218 1.0E-07
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 13 221 1.0E-07
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 13 161 1.0E-07
sp|P33981|TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens GN=TTK PE=1 SV=2 1 222 1.0E-07
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 17 264 1.0E-07
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 17 264 1.0E-07
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 17 264 1.0E-07
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 2 164 1.0E-07
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 12 229 1.0E-07
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 13 160 1.0E-07
sp|P53233|FMP48_YEAST Probable serine/threonine-protein kinase FMP48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP48 PE=1 SV=1 13 215 1.0E-07
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 13 161 1.0E-07
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 17 264 1.0E-07
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 13 218 1.0E-07
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 17 218 1.0E-07
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 13 140 2.0E-07
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 17 264 2.0E-07
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 13 219 2.0E-07
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 13 187 2.0E-07
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 13 218 2.0E-07
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 13 218 2.0E-07
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 18 221 2.0E-07
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 12 218 2.0E-07
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 13 187 2.0E-07
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 4 220 2.0E-07
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 13 218 2.0E-07
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 9 218 2.0E-07
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 13 176 2.0E-07
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 13 176 2.0E-07
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 13 218 2.0E-07
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 13 176 2.0E-07
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 1 218 2.0E-07
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 1 218 2.0E-07
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 19 187 2.0E-07
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 12 187 2.0E-07
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 1 218 2.0E-07
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 1 218 2.0E-07
sp|A1DES4|MPKC_NEOFI Mitogen-activated protein kinase mpkC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mpkc PE=3 SV=2 19 364 2.0E-07
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 17 218 2.0E-07
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 94 230 2.0E-07
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 13 176 2.0E-07
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 13 221 2.0E-07
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 12 264 2.0E-07
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 17 264 2.0E-07
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 17 264 2.0E-07
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 13 187 2.0E-07
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 14 225 2.0E-07
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 13 187 2.0E-07
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 115 234 2.0E-07
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 13 220 2.0E-07
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 17 185 2.0E-07
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 13 215 2.0E-07
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 13 218 2.0E-07
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 4 221 2.0E-07
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 12 264 2.0E-07
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 9 185 2.0E-07
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 19 187 2.0E-07
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 13 218 2.0E-07
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 17 264 2.0E-07
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 3 221 2.0E-07
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 13 187 2.0E-07
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 19 278 3.0E-07
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 13 218 3.0E-07
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 19 218 3.0E-07
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 19 218 3.0E-07
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 18 219 3.0E-07
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 13 187 3.0E-07
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 13 187 3.0E-07
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 13 228 3.0E-07
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 13 187 3.0E-07
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 18 221 3.0E-07
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 18 219 3.0E-07
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 109 268 3.0E-07
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 13 260 3.0E-07
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 13 187 3.0E-07
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 17 187 3.0E-07
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 13 187 3.0E-07
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 4 221 3.0E-07
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 7 221 3.0E-07
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 13 234 3.0E-07
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 17 215 3.0E-07
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 12 249 3.0E-07
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 13 234 3.0E-07
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 13 237 3.0E-07
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 13 187 3.0E-07
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 13 218 3.0E-07
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 13 187 3.0E-07
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 12 249 3.0E-07
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 4 218 3.0E-07
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 13 219 3.0E-07
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 95 264 3.0E-07
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 13 220 3.0E-07
sp|Q7TZN3|PKNE_MYCBO Serine/threonine-protein kinase PknE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknE PE=3 SV=1 13 221 4.0E-07
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 13 218 4.0E-07
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 13 221 4.0E-07
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 95 264 4.0E-07
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 17 185 4.0E-07
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 17 185 4.0E-07
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 13 234 4.0E-07
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 17 215 4.0E-07
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 13 218 4.0E-07
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 12 234 4.0E-07
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 13 176 4.0E-07
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 17 185 4.0E-07
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 17 215 4.0E-07
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 12 187 4.0E-07
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 13 187 4.0E-07
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 12 237 4.0E-07
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 12 221 4.0E-07
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 103 218 4.0E-07
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 13 185 4.0E-07
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 19 213 5.0E-07
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 13 234 5.0E-07
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 17 185 5.0E-07
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 115 220 5.0E-07
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 12 234 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4999
MASSSSNVVGVHYRVGKKIGEGSFGVIFEGTNLLNNQQVAIKFEPRKSDAPQLRDEYRTYKILVGCPGIPNVYYF
GQEGLHNILVIDLLGPSLEDLFDHCGRRFTIKTVVMVAKQMLSRVQTIHEKNLIYRDIKPDNFLIGRPGSKASNV
IHVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDLEALGHVFLYFLRGGLPWQGLKAA
TNKQKYEKIGEKKQTTAIKDLCEGFPEEFSKYLTYVRNLGFEDTPDYDYLRELFTQALKHAGEVEDGEYDWMKVS
KDSGKGWDSMKNHSAAYLHNPNARPGPSQMELHSGHRPGNTTHQQAQNLTVGRLNAAQPPPPSPIKQMGKQRDRP
SAPGAISAQRMSGVGGLREMGTPTGSTQAQFQNSTQNLPQQRLPQQSPMAAVGQPNVRPSEPQPSGFQKFIKTIC
CG*
Coding >OphauB2|4999
ATGGCCTCGTCGTCGTCAAACGTCGTTGGCGTCCACTATCGGGTTGGCAAGAAGATTGGAGAGGGCTCATTCGGC
GTCATTTTCGAGGGCACCAATCTCTTGAACAACCAGCAAGTTGCCATCAAGTTTGAACCTCGGAAGAGCGATGCT
CCCCAACTGCGAGATGAGTACCGAACATACAAAATCCTTGTGGGATGTCCCGGGATTCCTAATGTCTATTACTTT
GGCCAAGAGGGTCTTCACAACATCCTCGTCATCGATTTGCTTGGTCCCTCGCTCGAAGACCTCTTTGATCACTGT
GGCCGCCGCTTCACCATCAAGACTGTTGTCATGGTTGCCAAGCAGATGCTATCAAGGGTCCAGACAATACACGAA
AAGAACCTCATCTATCGAGACATCAAGCCCGACAACTTCCTGATAGGCAGACCAGGCTCCAAGGCTTCCAATGTC
ATTCATGTGGTGGACTTTGGCATGGCCAAGCAGTATCGAGACCCCAAGACTAAGCAACATATTCCCTACCGAGAG
CGCAAATCTCTGTCGGGAACTGCCCGCTACATGAGTATCAATACCCATTTGGGTCGCGAGCAATCCCGACGAGAC
GACCTCGAAGCCCTCGGCCACGTCTTTCTCTATTTTTTGCGAGGCGGCTTGCCCTGGCAGGGTCTCAAGGCTGCC
ACTAACAAGCAAAAGTACGAAAAAATTGGCGAGAAGAAACAGACAACGGCAATCAAGGATCTCTGCGAAGGCTTT
CCTGAAGAATTCTCAAAGTACCTGACCTATGTCCGCAATCTTGGCTTCGAGGACACTCCCGACTACGACTACCTC
CGCGAACTATTCACGCAGGCTCTCAAGCACGCCGGCGAGGTGGAGGATGGCGAGTACGACTGGATGAAGGTTAGC
AAGGATTCGGGAAAGGGTTGGGACTCTATGAAGAACCACAGCGCAGCCTATTTGCACAACCCAAACGCCCGGCCG
GGGCCGTCGCAGATGGAGTTACACAGTGGCCATCGCCCGGGAAACACTACGCACCAGCAGGCTCAAAATTTGACT
GTGGGCCGTTTAAACGCCGCACAGCCCCCCCCTCCATCACCCATCAAGCAGATGGGCAAACAGAGAGATCGGCCA
AGCGCGCCCGGCGCCATCTCGGCCCAGCGCATGAGTGGGGTGGGGGGTCTTCGAGAAATGGGCACGCCAACTGGC
TCTACGCAAGCCCAGTTCCAGAACAGCACTCAGAACCTTCCCCAGCAGAGACTGCCCCAACAGAGCCCCATGGCT
GCAGTCGGCCAGCCTAATGTGCGACCCTCGGAGCCTCAACCCAGCGGCTTCCAAAAGTTCATCAAGACCATCTGC
TGCGGTTAG
Transcript >OphauB2|4999
ATGGCCTCGTCGTCGTCAAACGTCGTTGGCGTCCACTATCGGGTTGGCAAGAAGATTGGAGAGGGCTCATTCGGC
GTCATTTTCGAGGGCACCAATCTCTTGAACAACCAGCAAGTTGCCATCAAGTTTGAACCTCGGAAGAGCGATGCT
CCCCAACTGCGAGATGAGTACCGAACATACAAAATCCTTGTGGGATGTCCCGGGATTCCTAATGTCTATTACTTT
GGCCAAGAGGGTCTTCACAACATCCTCGTCATCGATTTGCTTGGTCCCTCGCTCGAAGACCTCTTTGATCACTGT
GGCCGCCGCTTCACCATCAAGACTGTTGTCATGGTTGCCAAGCAGATGCTATCAAGGGTCCAGACAATACACGAA
AAGAACCTCATCTATCGAGACATCAAGCCCGACAACTTCCTGATAGGCAGACCAGGCTCCAAGGCTTCCAATGTC
ATTCATGTGGTGGACTTTGGCATGGCCAAGCAGTATCGAGACCCCAAGACTAAGCAACATATTCCCTACCGAGAG
CGCAAATCTCTGTCGGGAACTGCCCGCTACATGAGTATCAATACCCATTTGGGTCGCGAGCAATCCCGACGAGAC
GACCTCGAAGCCCTCGGCCACGTCTTTCTCTATTTTTTGCGAGGCGGCTTGCCCTGGCAGGGTCTCAAGGCTGCC
ACTAACAAGCAAAAGTACGAAAAAATTGGCGAGAAGAAACAGACAACGGCAATCAAGGATCTCTGCGAAGGCTTT
CCTGAAGAATTCTCAAAGTACCTGACCTATGTCCGCAATCTTGGCTTCGAGGACACTCCCGACTACGACTACCTC
CGCGAACTATTCACGCAGGCTCTCAAGCACGCCGGCGAGGTGGAGGATGGCGAGTACGACTGGATGAAGGTTAGC
AAGGATTCGGGAAAGGGTTGGGACTCTATGAAGAACCACAGCGCAGCCTATTTGCACAACCCAAACGCCCGGCCG
GGGCCGTCGCAGATGGAGTTACACAGTGGCCATCGCCCGGGAAACACTACGCACCAGCAGGCTCAAAATTTGACT
GTGGGCCGTTTAAACGCCGCACAGCCCCCCCCTCCATCACCCATCAAGCAGATGGGCAAACAGAGAGATCGGCCA
AGCGCGCCCGGCGCCATCTCGGCCCAGCGCATGAGTGGGGTGGGGGGTCTTCGAGAAATGGGCACGCCAACTGGC
TCTACGCAAGCCCAGTTCCAGAACAGCACTCAGAACCTTCCCCAGCAGAGACTGCCCCAACAGAGCCCCATGGCT
GCAGTCGGCCAGCCTAATGTGCGACCCTCGGAGCCTCAACCCAGCGGCTTCCAAAAGTTCATCAAGACCATCTGC
TGCGGTTAG
Gene >OphauB2|4999
ATGGCCTCGTCGTCGTCAAACGTCGTTGGCGTCCACTATCGGGTTGGCAAGAAGATTGGAGAGGGCTCATTCGGC
GTCATTTTCGAGGGCACCAATCTCTTGAACAACCAGCAAGTTGCCATCAAGTTTGTCAGTCGACCCCATTTGCCG
CGCTCCATTGCCCTTGCCTTCCTTGCTAACAAACGCCTCGATGCACAGGAACCTCGGAAGAGCGATGCTCCCCAA
CTGCGAGATGAGTACCGAACATACAAAATCCTTGTGGGATGTCGTAAGCTGCTTCTTGCTCGCTCCTTATCCTGT
CCGCCTCGCTCACTTTTTTGCCAACAGCCGGGATTCCTAATGTCTATTACTTTGGCCAAGAGGGTCTTCACAACA
TCCTCGTCATCGATTTGCTTGGTCCCTCGCTCGAAGACCTCTTTGATCACTGTGGCCGCCGCTTCACCATCAAGA
CTGTTGTCATGGTTGCCAAGCAGATGCTATCAAGGGTCCAGACAATACACGAAAAGAACCTCATCTATCGAGACA
TCAAGCCCGACAACTTCCTGATAGGCAGACCAGGCTCCAAGGCTTCCAATGTCATTCATGTGGTGGACTTTGGCA
TGGCCAAGCAGTATCGAGACCCCAAGACTAAGCAACATATTCCCTACCGAGAGCGCAAATCTCTGTCGGGAACTG
CCCGCTACATGAGTATCAATACCCATTTGGGTCGCGAGCAATCCCGACGAGACGACCTCGAAGCCCTCGGCCACG
TCTTTCTCTATTTTTTGCGAGGCGGCTTGCCCTGGCAGGGTCTCAAGGCTGCCACTAACAAGCAAAAGTACGAAA
AAATTGGCGAGAAGAAACAGACAACGGCAATCAAGGATCTCTGCGAAGGCTTTCCTGAAGAATTCTCAAAGTACC
TGACCTATGTCCGCAATCTTGGCTTCGAGGACACTCCCGACTACGACTACCTCCGCGAACTATTCACGCAGGCTC
TCAAGCACGCCGGCGAGGTGGAGGATGGCGAGTACGACTGGATGAAGGTTAGCAAGGATTCGGGAAAGGGTTGGG
ACTCTATGAAGAACCACAGCGCAGCCTATTTGCACAACCCAAACGCCCGGCCGGGGCCGTCGCAGATGGAGTTAC
ACAGTGGCCATCGCCCGGGAAACACTACGCACCAGCAGGCTCAAAATTTGACTGTGGGCCGTTTAAACGCCGCAC
AGCCCCCCCCTCCATCACCCATCAAGCAGATGGGCAAACAGAGAGATCGGCCAAGCGCGCCCGGCGCCATCTCGG
CCCAGCGCATGAGTGGGGTGGGGGGTCTTCGAGAAATGGGCACGCCAACTGGCTCTACGCAAGCCCAGTTCCAGA
ACAGCACTCAGAACCTTCCCCAGCAGAGACTGCCCCAACAGAGCCCCATGGCTGCAGTCGGCCAGCCTAATGTGC
GACCCTCGGAGCCTCAACCCAGCGGCTTCCAAAAGTTCATCAAGACCATCTGCTGCGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail