Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4994
Gene name
LocationContig_36:66770..69605
Strand+
Gene length (bp)2835
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13041 PPR_2 PPR repeat family 2.4E-07 881 919
PF01535 PPR PPR repeat 4.8E-02 882 911

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 841 921 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4994
MLRFWSPGQKLVTPSWQLTQRHHQLRRFATETSFGHQNSRCQQGEQDELDTNVREFRPRKPQPKVQDPSRQKPDS
RKRPSKNKHAASFEDKEPFTKEYAASCKKSNKFRRRHKPSMDSAASSQDYEASGSGSKASSNNVQKHKLQLEIPY
DLISNFKTDAQRDEAVADASIQPPKKEDEPLSNAVKKKRRRPAAKLKPALIPRYMSRKTGPNCSSLGPNATNLEK
IRRSIYKEWGYIRHQHAEDEVLPARRAFKKWKIQYHHVLDPVNPDSWPWRDKGKWLFELPNSDDIQSEWESLDVD
SRKEMWPHVMLSTMHLRPERAATVLAATMNPLPPGYAIHDVVLFLVNRLNFETMSRHKNKMLRAEEMLLIINRCL
KEMPAGHVRFQQRTFGLLCQKLPLELAGELYAVLNECNHPLHFNTKLQFASKLARGTVHKDTAFDLLRELVDGGT
DINDIRISSAITMLLFQQPGCAQPADKSPEFSPKKFLEYFVERGLSPTVGVATATLNTLCQQDKVEEAMQLALLF
LGCGVEFNSRTWTTLFRGAKDSLVADNIARALEVAIAANAMHVDVLNNVLHSVFYFANMESRQQRRATLWHSPLF
PHILRLYVSKFDLDALRDWLPKTLPWYLKQGPHVAQQQQQQRQKQEEQYGQLKQQLEQQQKEQEKPEQQHLVGGE
MNDTFNSKEAAKNAPASDDLKDVATSIAVPLKRRWMFEDSIMPVAHEFYSSSTSPILQPTPTTLSIVLRCFIRSL
RAADLVSYYELFTTRLEKLHAQRIPPPFVTHLPSLIHDTFIMVMMEHSFLARAALRVFGDMLRENATTDTNTTNT
NTTTTAPNHNTPLHPAPTMFTYNIILKGLFRRRDGHALAESVIGLMRLHGIQADRKTWNILIRGYANRQDVSSVV
AALHDMEAAGFSPDVFTYSGFGRLHDQKRAMDMMEEALENLRRL*
Coding >OphauB2|4994
ATGCTGCGATTTTGGTCGCCTGGACAAAAACTCGTTACCCCTAGCTGGCAGTTGACGCAACGCCACCATCAGCTG
CGCCGATTTGCAACAGAAACTTCTTTCGGGCACCAGAATTCGAGGTGCCAACAGGGAGAGCAAGACGAATTGGAC
ACAAATGTGCGCGAGTTTCGTCCTCGAAAACCACAGCCCAAGGTCCAGGACCCGAGCCGACAAAAGCCAGATTCC
CGCAAAAGACCATCCAAGAACAAACACGCCGCTTCTTTTGAGGACAAGGAGCCATTTACCAAGGAATACGCTGCC
TCTTGCAAGAAGTCGAATAAATTCAGACGTCGCCACAAACCATCTATGGACAGTGCTGCATCCTCCCAAGACTAC
GAAGCATCGGGCAGTGGTAGCAAAGCATCTTCAAATAACGTGCAAAAGCACAAGCTGCAACTCGAAATACCATAT
GACCTCATCTCCAATTTCAAGACGGACGCACAACGTGATGAGGCTGTCGCTGATGCTTCCATCCAGCCACCAAAA
AAAGAAGACGAGCCATTGTCAAACGCTGTCAAAAAAAAACGTCGACGACCCGCTGCAAAACTCAAGCCTGCCTTG
ATCCCCAGATACATGTCAAGGAAGACGGGGCCCAATTGTTCATCTCTTGGACCCAATGCCACAAACTTGGAAAAG
ATACGGCGGTCTATATACAAAGAATGGGGTTATATCCGACATCAACATGCGGAAGACGAGGTGTTACCAGCCAGA
AGAGCGTTCAAAAAGTGGAAGATTCAATACCACCATGTCCTGGATCCCGTCAATCCCGATTCGTGGCCATGGCGC
GATAAAGGCAAATGGCTATTCGAATTGCCTAACTCGGATGATATCCAGTCGGAATGGGAGTCTCTGGATGTCGAT
AGTCGAAAGGAGATGTGGCCCCATGTCATGCTTTCGACGATGCACCTCCGCCCGGAAAGGGCGGCCACCGTCTTG
GCTGCCACGATGAATCCCCTACCACCGGGATACGCGATCCATGATGTCGTCTTGTTTCTTGTCAATAGGCTCAAC
TTTGAGACCATGTCTCGCCATAAGAACAAGATGTTGCGGGCCGAAGAGATGCTTCTCATTATAAATCGGTGCCTA
AAGGAAATGCCAGCTGGCCACGTGCGCTTCCAGCAGAGGACATTTGGCCTCTTGTGCCAAAAGCTTCCTCTTGAG
CTGGCTGGGGAATTATACGCTGTCTTAAACGAGTGCAACCACCCTCTGCATTTCAACACGAAGCTGCAATTTGCT
TCAAAGCTGGCCAGAGGCACGGTGCACAAGGACACAGCTTTTGACCTGTTGCGAGAACTCGTTGATGGGGGTACA
GACATCAACGATATAAGGATATCCTCTGCCATCACTATGCTCCTCTTCCAACAGCCAGGATGTGCTCAGCCGGCA
GATAAGAGCCCCGAATTCTCGCCCAAGAAATTTCTTGAGTATTTTGTTGAGCGCGGCCTCTCCCCAACTGTCGGA
GTGGCAACCGCCACGCTCAACACTCTGTGCCAGCAGGACAAGGTGGAGGAAGCGATGCAGCTGGCCCTCTTGTTT
CTTGGCTGTGGCGTTGAATTTAACTCCAGGACTTGGACGACGCTATTCCGCGGCGCAAAAGATAGTCTTGTGGCG
GATAATATTGCCAGGGCGCTCGAAGTTGCCATAGCGGCCAACGCTATGCATGTCGATGTACTCAACAATGTCCTG
CATAGCGTCTTTTACTTTGCCAATATGGAGTCACGCCAGCAACGCCGCGCTACGCTTTGGCACTCCCCCCTGTTC
CCCCACATTCTGCGCCTCTATGTCAGCAAATTTGATCTCGACGCTTTACGCGACTGGCTCCCCAAGACGTTGCCC
TGGTACTTGAAGCAAGGACCACATGTGGCACAGCAACAGCAGCAGCAACGGCAGAAACAAGAGGAGCAATACGGG
CAACTAAAACAGCAACTAGAACAACAACAAAAGGAACAAGAGAAACCAGAGCAACAGCACCTCGTTGGCGGCGAA
ATGAACGACACTTTCAACAGCAAAGAAGCCGCTAAGAATGCCCCTGCAAGCGATGATCTCAAAGACGTTGCCACA
TCCATCGCGGTCCCTCTGAAAAGACGGTGGATGTTTGAGGATTCCATCATGCCCGTGGCCCATGAATTCTACTCG
AGCAGCACTTCGCCGATCCTACAGCCCACGCCAACAACTCTCTCCATTGTTCTCCGATGCTTCATCCGTAGCCTC
CGGGCCGCCGATCTCGTCTCCTACTATGAGTTGTTCACGACGCGTCTCGAGAAGCTCCATGCCCAGCGCATACCA
CCCCCCTTTGTCACGCATCTCCCAAGCCTCATCCACGACACCTTTATCATGGTCATGATGGAGCACTCTTTTCTA
GCCCGCGCCGCCTTGCGCGTCTTTGGCGACATGTTGCGTGAAAACGCCACTACTGATACTAATACTACTAATACT
AATACTACTACCACTGCCCCCAACCACAACACGCCTCTCCATCCTGCTCCGACAATGTTCACCTACAACATCATC
TTGAAGGGCCTGTTCAGGCGCCGCGACGGCCACGCCCTTGCCGAAAGCGTCATTGGCCTCATGCGCTTACATGGC
ATCCAGGCCGACCGCAAAACATGGAACATCTTGATTAGGGGCTATGCCAACAGACAAGACGTGTCTAGCGTCGTT
GCGGCCCTACACGACATGGAGGCGGCCGGCTTTTCTCCAGATGTCTTTACCTATAGCGGTTTTGGCCGACTTCAT
GACCAGAAACGAGCCATGGATATGATGGAGGAAGCTCTTGAAAATTTACGCCGGCTTTGA
Transcript >OphauB2|4994
ATGCTGCGATTTTGGTCGCCTGGACAAAAACTCGTTACCCCTAGCTGGCAGTTGACGCAACGCCACCATCAGCTG
CGCCGATTTGCAACAGAAACTTCTTTCGGGCACCAGAATTCGAGGTGCCAACAGGGAGAGCAAGACGAATTGGAC
ACAAATGTGCGCGAGTTTCGTCCTCGAAAACCACAGCCCAAGGTCCAGGACCCGAGCCGACAAAAGCCAGATTCC
CGCAAAAGACCATCCAAGAACAAACACGCCGCTTCTTTTGAGGACAAGGAGCCATTTACCAAGGAATACGCTGCC
TCTTGCAAGAAGTCGAATAAATTCAGACGTCGCCACAAACCATCTATGGACAGTGCTGCATCCTCCCAAGACTAC
GAAGCATCGGGCAGTGGTAGCAAAGCATCTTCAAATAACGTGCAAAAGCACAAGCTGCAACTCGAAATACCATAT
GACCTCATCTCCAATTTCAAGACGGACGCACAACGTGATGAGGCTGTCGCTGATGCTTCCATCCAGCCACCAAAA
AAAGAAGACGAGCCATTGTCAAACGCTGTCAAAAAAAAACGTCGACGACCCGCTGCAAAACTCAAGCCTGCCTTG
ATCCCCAGATACATGTCAAGGAAGACGGGGCCCAATTGTTCATCTCTTGGACCCAATGCCACAAACTTGGAAAAG
ATACGGCGGTCTATATACAAAGAATGGGGTTATATCCGACATCAACATGCGGAAGACGAGGTGTTACCAGCCAGA
AGAGCGTTCAAAAAGTGGAAGATTCAATACCACCATGTCCTGGATCCCGTCAATCCCGATTCGTGGCCATGGCGC
GATAAAGGCAAATGGCTATTCGAATTGCCTAACTCGGATGATATCCAGTCGGAATGGGAGTCTCTGGATGTCGAT
AGTCGAAAGGAGATGTGGCCCCATGTCATGCTTTCGACGATGCACCTCCGCCCGGAAAGGGCGGCCACCGTCTTG
GCTGCCACGATGAATCCCCTACCACCGGGATACGCGATCCATGATGTCGTCTTGTTTCTTGTCAATAGGCTCAAC
TTTGAGACCATGTCTCGCCATAAGAACAAGATGTTGCGGGCCGAAGAGATGCTTCTCATTATAAATCGGTGCCTA
AAGGAAATGCCAGCTGGCCACGTGCGCTTCCAGCAGAGGACATTTGGCCTCTTGTGCCAAAAGCTTCCTCTTGAG
CTGGCTGGGGAATTATACGCTGTCTTAAACGAGTGCAACCACCCTCTGCATTTCAACACGAAGCTGCAATTTGCT
TCAAAGCTGGCCAGAGGCACGGTGCACAAGGACACAGCTTTTGACCTGTTGCGAGAACTCGTTGATGGGGGTACA
GACATCAACGATATAAGGATATCCTCTGCCATCACTATGCTCCTCTTCCAACAGCCAGGATGTGCTCAGCCGGCA
GATAAGAGCCCCGAATTCTCGCCCAAGAAATTTCTTGAGTATTTTGTTGAGCGCGGCCTCTCCCCAACTGTCGGA
GTGGCAACCGCCACGCTCAACACTCTGTGCCAGCAGGACAAGGTGGAGGAAGCGATGCAGCTGGCCCTCTTGTTT
CTTGGCTGTGGCGTTGAATTTAACTCCAGGACTTGGACGACGCTATTCCGCGGCGCAAAAGATAGTCTTGTGGCG
GATAATATTGCCAGGGCGCTCGAAGTTGCCATAGCGGCCAACGCTATGCATGTCGATGTACTCAACAATGTCCTG
CATAGCGTCTTTTACTTTGCCAATATGGAGTCACGCCAGCAACGCCGCGCTACGCTTTGGCACTCCCCCCTGTTC
CCCCACATTCTGCGCCTCTATGTCAGCAAATTTGATCTCGACGCTTTACGCGACTGGCTCCCCAAGACGTTGCCC
TGGTACTTGAAGCAAGGACCACATGTGGCACAGCAACAGCAGCAGCAACGGCAGAAACAAGAGGAGCAATACGGG
CAACTAAAACAGCAACTAGAACAACAACAAAAGGAACAAGAGAAACCAGAGCAACAGCACCTCGTTGGCGGCGAA
ATGAACGACACTTTCAACAGCAAAGAAGCCGCTAAGAATGCCCCTGCAAGCGATGATCTCAAAGACGTTGCCACA
TCCATCGCGGTCCCTCTGAAAAGACGGTGGATGTTTGAGGATTCCATCATGCCCGTGGCCCATGAATTCTACTCG
AGCAGCACTTCGCCGATCCTACAGCCCACGCCAACAACTCTCTCCATTGTTCTCCGATGCTTCATCCGTAGCCTC
CGGGCCGCCGATCTCGTCTCCTACTATGAGTTGTTCACGACGCGTCTCGAGAAGCTCCATGCCCAGCGCATACCA
CCCCCCTTTGTCACGCATCTCCCAAGCCTCATCCACGACACCTTTATCATGGTCATGATGGAGCACTCTTTTCTA
GCCCGCGCCGCCTTGCGCGTCTTTGGCGACATGTTGCGTGAAAACGCCACTACTGATACTAATACTACTAATACT
AATACTACTACCACTGCCCCCAACCACAACACGCCTCTCCATCCTGCTCCGACAATGTTCACCTACAACATCATC
TTGAAGGGCCTGTTCAGGCGCCGCGACGGCCACGCCCTTGCCGAAAGCGTCATTGGCCTCATGCGCTTACATGGC
ATCCAGGCCGACCGCAAAACATGGAACATCTTGATTAGGGGCTATGCCAACAGACAAGACGTGTCTAGCGTCGTT
GCGGCCCTACACGACATGGAGGCGGCCGGCTTTTCTCCAGATGTCTTTACCTATAGCGGTTTTGGCCGACTTCAT
GACCAGAAACGAGCCATGGATATGATGGAGGAAGCTCTTGAAAATTTACGCCGGCTTTGA
Gene >OphauB2|4994
ATGCTGCGATTTTGGTCGCCTGGACAAAAACTCGTTACCCCTAGCTGGCAGTTGACGCAACGCCACCATCAGCTG
CGCCGATTTGCAACAGAAACTTCTTTCGGGCACCAGAATTCGAGGTGCCAACAGGGAGAGCAAGACGAATTGGAC
ACAAATGTGCGCGAGTTTCGTCCTCGAAAACCACAGCCCAAGGTCCAGGACCCGAGCCGACAAAAGCCAGATTCC
CGCAAAAGACCATCCAAGAACAAACACGCCGCTTCTTTTGAGGACAAGGAGCCATTTACCAAGGAATACGCTGCC
TCTTGCAAGAAGTCGAATAAATTCAGACGTCGCCACAAACCATCTATGGACAGTGCTGCATCCTCCCAAGACTAC
GAAGCATCGGGCAGTGGTAGCAAAGCATCTTCAAATAACGTGCAAAAGCACAAGCTGCAACTCGAAATACCATAT
GACCTCATCTCCAATTTCAAGACGGACGCACAACGTGATGAGGCTGTCGCTGATGCTTCCATCCAGCCACCAAAA
AAAGAAGACGAGCCATTGTCAAACGCTGTCAAAAAAAAACGTCGACGACCCGCTGCAAAACTCAAGCCTGCCTTG
ATCCCCAGATACATGTCAAGGAAGACGGGGCCCAATTGTTCATCTCTTGGACCCAATGCCACAAACTTGGAAAAG
ATACGGCGGTCTATATACAAAGAATGGGGTTATATCCGACATCAACATGCGGAAGACGAGGTGTTACCAGCCAGA
AGAGCGTTCAAAAAGTGGAAGATTCAATACCACCATGTCCTGGATCCCGTCAATCCCGATTCGTGGCCATGGCGC
GATAAAGGCAAATGGCTATTCGAATTGCCTAACTCGGATGATATCCAGTCGGAATGGGAGTCTCTGGATGTCGAT
AGTCGAAAGGAGATGTGGCCCCATGTCATGCTTTCGACGATGCACCTCCGCCCGGAAAGGGCGGCCACCGTCTTG
GCTGCCACGATGAATCCCCTACCACCGGGATACGCGATCCATGATGTCGTCTTGTTTCTTGTCAATAGGCTCAAC
TTTGAGACCATGTCTCGCCATAAGAACAAGATGTTGCGGGCCGAAGAGATGCTTCTCATTATAAATCGGTGCCTA
AAGGAAATGCCAGCTGGCCACGTGCGCTTCCAGCAGAGGACATTTGGCCTCTTGTGCCAAAAGCTTCCTCTTGAG
CTGGCTGGGGAATTATACGCTGTCTTAAACGAGTGCAACCACCCTCTGCATTTCAACACGAAGCTGCAATTTGCT
TCAAAGCTGGCCAGAGGCACGGTGCACAAGGACACAGCTTTTGACCTGTTGCGAGAACTCGTTGATGGGGGTACA
GACATCAACGATATAAGGATATCCTCTGCCATCACTATGCTCCTCTTCCAACAGCCAGGATGTGCTCAGCCGGCA
GATAAGAGCCCCGAATTCTCGCCCAAGAAATTTCTTGAGTATTTTGTTGAGCGCGGCCTCTCCCCAACTGTCGGA
GTGGCAACCGCCACGCTCAACACTCTGTGCCAGCAGGACAAGGTGGAGGAAGCGATGCAGCTGGCCCTCTTGTTT
CTTGGCTGTGGCGTTGAATTTAACTCCAGGACTTGGACGACGCTATTCCGCGGCGCAAAAGATAGTCTTGTGGCG
GATAATATTGCCAGGGCGCTCGAAGTTGCCATAGCGGCCAACGCTATGCATGTCGATGTACTCAACAATGTCCTG
CATAGCGTCTTTTACTTTGCCAATATGGAGTCACGCCAGCAACGCCGCGCTACGCTTTGGCACTCCCCCCTGTTC
CCCCACATTCTGCGCCTCTATGTCAGCAAATTTGATCTCGACGCTTTACGCGACTGGCTCCCCAAGACGTTGCCC
TGGTACTTGAAGCAAGGACCACATGTGGCACAGCAACAGCAGCAGCAACGGCAGAAACAAGAGGAGCAATACGGG
CAACTAAAACAGCAACTAGAACAACAACAAAAGGAACAAGAGAAACCAGAGCAACAGCACCTCGTTGGCGGCGAA
ATGAACGACACTTTCAACAGCAAAGAAGCCGCTAAGAATGCCCCTGCAAGCGATGATCTCAAAGACGTTGCCACA
TCCATCGCGGTCCCTCTGAAAAGACGGTGGATGTTTGAGGATTCCATCATGCCCGTGGCCCATGAATTCTACTCG
AGCAGCACTTCGCCGATCCTACAGCCCACGCCAACAACTCTCTCCATTGTTCTCCGATGCTTCATCCGTAGCCTC
CGGGCCGCCGATCTCGTCTCCTACTATGAGTTGTTCACGACGCGTCTCGAGAAGCTCCATGCCCAGCGCATACCA
CCCCCCTTTGTCACGCATCTCCCAAGCCTCATCCACGACACCTTTATCATGGTCATGATGGAGCACTCTTTTCTA
GCCCGCGCCGCCTTGCGCGTCTTTGGCGACATGTTGCGTGAAAACGCCACTACTGATACTAATACTACTAATACT
AATACTACTACCACTGCCCCCAACCACAACACGCCTCTCCATCCTGCTCCGACAATGTTCACCTACAACATCATC
TTGAAGGGCCTGTTCAGGCGCCGCGACGGCCACGCCCTTGCCGAAAGCGTCATTGGCCTCATGCGCTTACATGGC
ATCCAGGCCGACCGCAAAACATGGAACATCTTGATTAGGGGCTATGCCAACAGACAAGACGTGTCTAGCGTCGTT
GCGGCCCTACACGACATGGAGGCGGCCGGCTTTTCTCCAGATGTCTTTACCTATAGCGGTTTTGGCCGACTTCAT
GACCAGAAACGAGCCATGGATATGATGGAGGAAGCTCTTGAAAATTTACGCCGGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail