Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4985
Gene name
LocationContig_36:47258..48910
Strand-
Gene length (bp)1652
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01757 Acyl_transf_3 Acyltransferase family 5.7E-42 101 501

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22
2 146 168 22
3 195 217 22
4 275 297 22
5 474 496 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4985
MSGHSFLRHTLSQEEEMGLLDERTVSDVESEVSPIDVERRHRSKKITMPKSPGLLNITWDNICRSQWRVLLVRFF
VFLTPSFLQDRHAREQICPAKLSPTAYLDGMRGLAALFVFFCHYSYQAFVIAEGWGCGETNYHFLKLPLIRIWYQ
GPPAVCVFFVISGYALSYRPLKLARSRAFSDFSTTMSSMIFRRGIRLYLPTIISTFMIICLLRIGAYEWTRDFAN
DRTYMKNIVEPHPQRMASAYNQYRDWLIHMYKFVHVFGWERFGGSTSYDVHLWTIPVEFRCSLYLFLVLVGTARL
QTRFRFLFVGGIIWFTYRQSRWELLLFFFGMLLAEWDHIRGAHLAPTLPHDEKQLPQSRQLYKRLFWAFLSIVGL
YLLCQPDGRGEITPGWRYLTSSIPSWWKEEKYRYWQSTGAIIFVLAVGHSKRWQRFFNTPVVQYFGKISYAMYLM
HGPAMHTVGYHWEKLAYRLTGVEGYWYNAGFVLGACFCVPTVIWWADIFWRAIDIPTVKFAKWFERQCIVKDEEP
*
Coding >OphauB2|4985
ATGAGTGGACACTCGTTTTTGAGGCACACCCTCTCCCAGGAGGAGGAAATGGGCCTCTTGGACGAACGAACCGTC
TCGGACGTGGAGAGCGAAGTCAGCCCTATAGATGTCGAGCGTCGCCACCGCTCCAAAAAGATCACGATGCCCAAA
TCACCGGGCTTGCTCAATATCACCTGGGACAATATCTGCCGGTCGCAGTGGCGCGTCCTTCTTGTCCGCTTCTTC
GTCTTCTTGACGCCCAGTTTTCTTCAAGACCGCCACGCCCGAGAGCAGATATGTCCAGCCAAGTTATCCCCCACG
GCATACCTGGATGGAATGCGTGGCTTGGCTGCTCTTTTCGTCTTCTTCTGCCACTATTCTTATCAGGCCTTTGTC
ATTGCCGAAGGCTGGGGTTGCGGCGAGACCAACTACCACTTTTTGAAGCTGCCGCTTATCCGCATATGGTACCAG
GGTCCTCCAGCAGTCTGCGTCTTCTTCGTCATTTCTGGATACGCCCTGTCGTATCGGCCCCTCAAGCTGGCACGC
AGCCGGGCCTTCTCAGACTTTTCTACGACCATGAGCTCTATGATCTTTCGACGAGGCATTCGCCTGTATCTGCCA
ACAATCATCTCAACCTTTATGATCATATGCTTGCTGCGTATTGGAGCATACGAGTGGACGCGCGACTTCGCCAAC
GACCGAACTTATATGAAGAACATCGTGGAGCCGCATCCTCAACGGATGGCGAGCGCTTACAATCAATACAGAGAT
TGGCTTATTCACATGTATAAGTTTGTCCATGTGTTTGGTTGGGAAAGATTTGGGGGTAGTACCAGCTACGACGTG
CACTTGTGGACAATTCCTGTTGAATTCCGATGCTCGCTTTACTTGTTTCTGGTGCTTGTTGGAACCGCGCGGCTA
CAAACGAGATTCCGATTTTTATTCGTCGGCGGCATCATTTGGTTCACGTATCGTCAATCTCGATGGGAGCTCCTG
CTCTTCTTCTTTGGCATGCTTCTGGCTGAATGGGATCACATTCGGGGAGCCCACCTTGCTCCTACGCTGCCACAT
GATGAAAAGCAATTGCCCCAATCTCGCCAGCTTTACAAGAGACTGTTTTGGGCGTTTCTGAGCATAGTAGGACTC
TACTTGCTGTGCCAGCCAGACGGACGAGGAGAAATTACTCCGGGATGGCGCTACCTCACTTCGAGTATCCCGAGC
TGGTGGAAGGAAGAAAAATATCGATACTGGCAGTCAACTGGCGCCATCATTTTCGTCTTGGCGGTTGGGCACTCG
AAGCGTTGGCAACGTTTTTTCAACACGCCTGTGGTGCAGTACTTTGGCAAGATTTCTTACGCCATGTACCTGATG
CACGGGCCGGCAATGCACACAGTCGGGTATCACTGGGAAAAGTTGGCGTACAGGCTGACAGGTGTGGAGGGCTAC
TGGTACAATGCGGGCTTTGTGTTGGGTGCTTGCTTTTGCGTGCCCACGGTGATATGGTGGGCCGACATTTTTTGG
CGCGCCATTGACATACCGACTGTCAAGTTCGCCAAGTGGTTTGAACGACAATGCATTGTCAAGGACGAGGAGCCA
TGA
Transcript >OphauB2|4985
ATGAGTGGACACTCGTTTTTGAGGCACACCCTCTCCCAGGAGGAGGAAATGGGCCTCTTGGACGAACGAACCGTC
TCGGACGTGGAGAGCGAAGTCAGCCCTATAGATGTCGAGCGTCGCCACCGCTCCAAAAAGATCACGATGCCCAAA
TCACCGGGCTTGCTCAATATCACCTGGGACAATATCTGCCGGTCGCAGTGGCGCGTCCTTCTTGTCCGCTTCTTC
GTCTTCTTGACGCCCAGTTTTCTTCAAGACCGCCACGCCCGAGAGCAGATATGTCCAGCCAAGTTATCCCCCACG
GCATACCTGGATGGAATGCGTGGCTTGGCTGCTCTTTTCGTCTTCTTCTGCCACTATTCTTATCAGGCCTTTGTC
ATTGCCGAAGGCTGGGGTTGCGGCGAGACCAACTACCACTTTTTGAAGCTGCCGCTTATCCGCATATGGTACCAG
GGTCCTCCAGCAGTCTGCGTCTTCTTCGTCATTTCTGGATACGCCCTGTCGTATCGGCCCCTCAAGCTGGCACGC
AGCCGGGCCTTCTCAGACTTTTCTACGACCATGAGCTCTATGATCTTTCGACGAGGCATTCGCCTGTATCTGCCA
ACAATCATCTCAACCTTTATGATCATATGCTTGCTGCGTATTGGAGCATACGAGTGGACGCGCGACTTCGCCAAC
GACCGAACTTATATGAAGAACATCGTGGAGCCGCATCCTCAACGGATGGCGAGCGCTTACAATCAATACAGAGAT
TGGCTTATTCACATGTATAAGTTTGTCCATGTGTTTGGTTGGGAAAGATTTGGGGGTAGTACCAGCTACGACGTG
CACTTGTGGACAATTCCTGTTGAATTCCGATGCTCGCTTTACTTGTTTCTGGTGCTTGTTGGAACCGCGCGGCTA
CAAACGAGATTCCGATTTTTATTCGTCGGCGGCATCATTTGGTTCACGTATCGTCAATCTCGATGGGAGCTCCTG
CTCTTCTTCTTTGGCATGCTTCTGGCTGAATGGGATCACATTCGGGGAGCCCACCTTGCTCCTACGCTGCCACAT
GATGAAAAGCAATTGCCCCAATCTCGCCAGCTTTACAAGAGACTGTTTTGGGCGTTTCTGAGCATAGTAGGACTC
TACTTGCTGTGCCAGCCAGACGGACGAGGAGAAATTACTCCGGGATGGCGCTACCTCACTTCGAGTATCCCGAGC
TGGTGGAAGGAAGAAAAATATCGATACTGGCAGTCAACTGGCGCCATCATTTTCGTCTTGGCGGTTGGGCACTCG
AAGCGTTGGCAACGTTTTTTCAACACGCCTGTGGTGCAGTACTTTGGCAAGATTTCTTACGCCATGTACCTGATG
CACGGGCCGGCAATGCACACAGTCGGGTATCACTGGGAAAAGTTGGCGTACAGGCTGACAGGTGTGGAGGGCTAC
TGGTACAATGCGGGCTTTGTGTTGGGTGCTTGCTTTTGCGTGCCCACGGTGATATGGTGGGCCGACATTTTTTGG
CGCGCCATTGACATACCGACTGTCAAGTTCGCCAAGTGGTTTGAACGACAATGCATTGTCAAGGACGAGGAGCCA
TGA
Gene >OphauB2|4985
ATGAGTGGACACTCGTTTTTGAGGCACACCCTCTCCCAGGAGGAGGAAATGGGCCTCTTGGACGAACGAACCGTC
TCGGACGTGGAGAGCGAAGTCAGCCCTATAGATGTCGAGCGTCGCCACCGCTCCAAAAAGATCACGATGCCCAAA
TCACCGGGCTTGCTCAATATCACCTGGGACAATATCTGCCGGTCGCAGTGGCGCGTCCTTCTTGTCCGCTTCTTC
GTCTTCTTGACGCCCAGTTTTCTTCAAGACCGCCACGCCCGAGAGCAGATATGTCCAGCCAAGTTATCCCCCACG
GCATACCTGGATGGAATGCGTGGCTTGGCTGCTCTTTTCGTCTTCTTCTGCCACTATTCTTATCAGGCCTTTGTC
ATTGCCGAAGGCTGGGGTTGCGGCGAGACCAACTACCACTTTTTGAAGCTGCCGCTTATCCGCATATGGTACCAG
GGTCCTCCAGCAGTCTGCGTCTTCTTCGTCATTTCTGGATACGCCCTGTCGTATCGGCCCCTCAAGCTGGCACGC
AGCCGGGCCTTCTCAGACTTTTCTACGACCATGAGCTCTATGATCTTTCGACGAGGCATTCGCCTGTATCTGCCA
ACAATCATCTCAACCTTTATGATCATATGCTTGCTGCGTATTGGAGCATACGAGTGGACGCGCGACTTCGCCAAC
GACCGAACTTATATGAAGAACATCGTGGAGCCGCATCCTCAACGGATGGCGAGCGCTTACAATCAATACAGAGAT
TGGCTTATTCACATGTATAAGTTTGTCCATGTGTTTGGTTGGGAAAGATTTGGGGGTAGTACCAGTAAGACAATG
CCCTTTAGTCTTGTTTTACTTGCCCTACCCAAGACATGGCAGCTGCTTACGCATTTTTGACAGGCTACGACGTGC
ACTTGTGGACAATTCCTGTTGAATTCCGATGCTCGCTTTACTTGTTTCTGGTGCTTGTTGGAACCGCGCGGCTAC
AAACGAGATTCCGATTTTTATTCGTCGGCGGCATCATTTGGTTCACGTATCGTCAATCTCGATGGGAGCTCCTGC
TCTTCTTCTTTGGCATGCTTCTGGCTGAATGGGATCACATTCGGGGAGCCCACCTTGCTCCTACGCTGCCACATG
ATGAAAAGCAATTGCCCCAATCTCGCCAGCTTTACAAGAGACTGTTTTGGGCGTTTCTGAGCATAGTAGGACTCT
ACTTGCTGTGCCAGCCAGACGGACGAGGAGAAATTACTCCGGGATGGCGCTACCTCACTTCGAGTATCCCGAGCT
GGTGGAAGGAAGAAAAATATCGATACTGGCAGTCAACTGGCGCCATCATTTTCGTCTTGGCGGTTGGGCACTCGA
AGCGTTGGCAACGTTTTTTCAACACGCCTGTGGTGCAGTACTTTGGCAAGATTTCTTACGCCATGTACCTGATGC
ACGGGCCGGCAATGCACACAGTCGGGTATCACTGGGAAAAGTTGGCGTACAGGCTGACAGGTGTGGAGGGCTACT
GGTACAATGCGGGCTTTGTGTTGGGTGCTTGCTTTTGCGTGCCCACGGTGATATGGTGGGCCGACATTTTTTGGC
GCGCCATTGACATACCGACTGTCAAGTTCGCCAAGTGGTTTGAACGACAATGCATTGTCAAGGACGAGGAGCCAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail