Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4978
Gene name
LocationContig_36:34728..35604
Strand-
Gene length (bp)876
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06916 FAM210A-B_dom FAM210A/B-like domain 1.1E-24 97 231

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URV4|YBL7_SCHPO Uncharacterized protein C106.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.07c PE=4 SV=1 91 237 2.0E-22
sp|P37293|NAT2_YEAST N-terminal acetyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT2 PE=1 SV=2 98 247 5.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 106 128 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4978
MPPSLPARAIWPASVGVRLASMRIALASSRPVWRRLFSSASARNAPASPLPPLRPRWASGHSNFRTAKPQHRSFS
FSAWRGAGNGSKAPQRLSLGARLKKLSREYGWTAVGVYLGLSVLDFPFCFLLVRIVGTEKIGKIEHYIVSAIKNV
VPDSVRESATQFWNSIRKQESKELGDDTISEKVEMAGWGVQEAQQRNDEEASLATQLALAYAIHKSFIFIRVPLT
AAVTPKVVKVLRSWGWNIGKRKSSRP*
Coding >OphauB2|4978
ATGCCACCGTCTTTGCCTGCGCGCGCCATTTGGCCAGCATCAGTGGGCGTGCGGCTTGCTTCCATGAGAATAGCC
TTGGCCTCGTCGCGGCCCGTCTGGAGACGCCTCTTCAGCTCAGCGTCGGCACGCAATGCGCCCGCCAGCCCTCTG
CCGCCGCTGCGCCCAAGGTGGGCGTCTGGCCACTCCAACTTCAGGACCGCCAAGCCGCAGCACCGCTCTTTCAGC
TTTTCAGCCTGGAGAGGAGCCGGCAATGGCTCCAAGGCACCCCAGAGACTTTCCCTAGGTGCCCGCCTCAAAAAG
CTTTCCAGGGAATACGGCTGGACGGCTGTCGGCGTCTACCTCGGTCTCAGCGTCCTCGACTTTCCCTTTTGCTTC
CTGCTTGTCAGAATAGTTGGCACAGAGAAAATTGGCAAAATCGAGCATTACATTGTCTCGGCCATCAAGAATGTA
GTGCCCGACAGTGTGCGCGAATCGGCCACTCAATTCTGGAACTCTATAAGAAAGCAAGAGTCAAAAGAGCTTGGC
GACGATACCATAAGTGAAAAGGTGGAAATGGCCGGATGGGGCGTCCAAGAAGCTCAGCAGCGCAACGATGAGGAA
GCCAGTCTTGCGACGCAATTGGCGCTTGCCTACGCCATCCACAAGAGCTTCATCTTTATCCGAGTTCCCCTTACC
GCGGCCGTGACACCAAAGGTTGTCAAAGTTTTGCGATCGTGGGGCTGGAACATTGGAAAGCGCAAGTCTTCGCGA
CCATGA
Transcript >OphauB2|4978
ATGCCACCGTCTTTGCCTGCGCGCGCCATTTGGCCAGCATCAGTGGGCGTGCGGCTTGCTTCCATGAGAATAGCC
TTGGCCTCGTCGCGGCCCGTCTGGAGACGCCTCTTCAGCTCAGCGTCGGCACGCAATGCGCCCGCCAGCCCTCTG
CCGCCGCTGCGCCCAAGGTGGGCGTCTGGCCACTCCAACTTCAGGACCGCCAAGCCGCAGCACCGCTCTTTCAGC
TTTTCAGCCTGGAGAGGAGCCGGCAATGGCTCCAAGGCACCCCAGAGACTTTCCCTAGGTGCCCGCCTCAAAAAG
CTTTCCAGGGAATACGGCTGGACGGCTGTCGGCGTCTACCTCGGTCTCAGCGTCCTCGACTTTCCCTTTTGCTTC
CTGCTTGTCAGAATAGTTGGCACAGAGAAAATTGGCAAAATCGAGCATTACATTGTCTCGGCCATCAAGAATGTA
GTGCCCGACAGTGTGCGCGAATCGGCCACTCAATTCTGGAACTCTATAAGAAAGCAAGAGTCAAAAGAGCTTGGC
GACGATACCATAAGTGAAAAGGTGGAAATGGCCGGATGGGGCGTCCAAGAAGCTCAGCAGCGCAACGATGAGGAA
GCCAGTCTTGCGACGCAATTGGCGCTTGCCTACGCCATCCACAAGAGCTTCATCTTTATCCGAGTTCCCCTTACC
GCGGCCGTGACACCAAAGGTTGTCAAAGTTTTGCGATCGTGGGGCTGGAACATTGGAAAGCGCAAGTCTTCGCGA
CCATGA
Gene >OphauB2|4978
ATGCCACCGTCTTTGCCTGCGCGCGCCATTTGGCCAGCATCAGTGGGCGTGCGGCTTGCTTCCATGAGAATAGCC
TTGGCCTCGTCGCGGCCCGTCTGGAGACGCCTCTTCAGCTCAGCGTCGGCACGCAATGCGCCCGCCAGCCCTCTG
CCGCCGCTGCGCCCAAGGTGGGCGTCTGGCCACTCCAACTTCAGGACCGCCAAGCCGCAGCACCGCTCTTTCAGC
TTTTCAGCCTGGAGAGGAGCCGGCAATGGCTCCAAGGCACCCCAGAGACTTTCCCTAGGTGCCCGCCTCAAAAAG
CTTTCCAGGGAATACGGCTGGACGGCTGTCGGCGTCTACCTCGGTCTCAGCGTCCTCGACTTTCCCTTTTGCTTC
CTGCTTGTCAGAATAGTTGGCACAGAGAAAATTGGTAACCAACAAGCTCACGCTCCATAAGCAGCTCCCGCTGAC
GCGTCGAGCCTTGTCTCGCATCAGGCAAAATCGAGCATTACATTGTCTCGGCCATCAAGAATGTAGTGCCCGACA
GTGTGCGCGAATCGGCCACTCAATTCTGGAACTCTATAAGAAAGCAAGAGTCAAAAGAGCTTGGCGACGATACCA
TAAGTGAAAAGGTGGAAATGGCCGGATGGGGCGTCCAAGAAGCTCAGCAGCGCAACGATGAGGAAGCCAGTGAGT
AACCAACAGTATTTGCCCCAGCGCTACCCTCTCACATTCCTGCTCCTAGGTCTTGCGACGCAATTGGCGCTTGCC
TACGCCATCCACAAGAGCTTCATCTTTATCCGAGTTCCCCTTACCGCGGCCGTGACACCAAAGGTTGTCAAAGTT
TTGCGATCGTGGGGCTGGAACATTGGAAAGCGCAAGTCTTCGCGACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail