Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4971
Gene name
LocationContig_36:9622..11515
Strand-
Gene length (bp)1893
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03969 AFG1_ATPase AFG1-like ATPase 3.2E-22 122 244
PF03969 AFG1_ATPase AFG1-like ATPase 2.6E-17 346 461

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3V384|LACE1_MOUSE Lactation elevated protein 1 OS=Mus musculus GN=Lace1 PE=1 SV=1 125 560 1.0E-36
sp|Q32PX9|LACE1_RAT Lactation elevated protein 1 OS=Rattus norvegicus GN=Lace1 PE=2 SV=1 125 560 1.0E-35
sp|P46441|N2B_HAEIR Putative ATPase N2B OS=Haematobia irritans PE=2 SV=1 2 555 4.0E-35
sp|Q8WV93|LACE1_HUMAN Lactation elevated protein 1 OS=Homo sapiens GN=LACE1 PE=1 SV=2 125 560 3.0E-34
sp|Q5TYS0|LCE1B_DANRE Lactation elevated protein 1 homolog B OS=Danio rerio GN=lace1b PE=2 SV=1 125 461 7.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3V384|LACE1_MOUSE Lactation elevated protein 1 OS=Mus musculus GN=Lace1 PE=1 SV=1 125 560 1.0E-36
sp|Q32PX9|LACE1_RAT Lactation elevated protein 1 OS=Rattus norvegicus GN=Lace1 PE=2 SV=1 125 560 1.0E-35
sp|P46441|N2B_HAEIR Putative ATPase N2B OS=Haematobia irritans PE=2 SV=1 2 555 4.0E-35
sp|Q8WV93|LACE1_HUMAN Lactation elevated protein 1 OS=Homo sapiens GN=LACE1 PE=1 SV=2 125 560 3.0E-34
sp|Q5TYS0|LCE1B_DANRE Lactation elevated protein 1 homolog B OS=Danio rerio GN=lace1b PE=2 SV=1 125 461 7.0E-31
sp|O42895|YBQ2_SCHPO Uncharacterized protein C115.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.02c PE=3 SV=1 13 468 1.0E-30
sp|P32317|AFG1_YEAST Protein AFG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG1 PE=1 SV=1 13 560 1.0E-26
sp|P64612|ZAPE_ECOLI Cell division protein ZapE OS=Escherichia coli (strain K12) GN=zapE PE=1 SV=1 46 461 4.0E-21
sp|P64613|ZAPE_ECO57 Cell division protein ZapE OS=Escherichia coli O157:H7 GN=zapE PE=3 SV=1 46 461 4.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6498
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7253
Ophiocordyceps australis map64 (Brazil) OphauB2|4971 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1072

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4971
MRRFSTALTITDPLVKYQTLVKSGVYAPDQAQHRLARHLGNVYLRIKDYSPHVEYRQKLSQVASLTDKKPLDHQD
EAGSTLALRNHGIWRNPLFRHLLPAVEETSSLALTRVLSGHDAAVEIDSPKGLFVSGEVGTGKSMLLDLLADGLP
SQRKKRWHFNTFMLYTLSQLDKHRASQTSGQQLEYSLAWMAKKLVDQSPILFLDEFQLPDRAASKILSHLFILFF
QLGGVLVASSNRIPEELQKATGVEYAPGPTRGLVSKMLGSSRFKGELYGQSSDFANFLKVLKARCDFWQMDGTND
WRRREESISPDSSPAKSTAGSSSPTPGSDGHGARKRPHHYHVMGQDDDNWEQTIRDATSWTGAEERWWEPSSVVV
YGRRICIPQHHNGFVLWKFAKLVEAFGPADYITLASSYHTFIVDEVPILTVLDKNEARRFITFVDALYEARCKLV
IRAASPPDDLFFPNTPGQPPRTTDSQSSDATYSETVAEVYQDQTSPFRPNISYYDSPTATSRYSPDQDSDFGLER
PQVDFVNAGTFTGEDERFAYKRAASRLWELCSARWHARTGDWWRPLPSEARHWEAGPVSNPLQPGAVAQGTSSGE
GMGKSIEVDELAGLSKWRIQDLEKQSRGGG*
Coding >OphauB2|4971
ATGAGACGCTTCTCAACTGCGCTCACCATTACTGACCCGCTCGTCAAGTACCAGACCCTGGTCAAATCTGGCGTC
TACGCTCCCGATCAGGCCCAGCACCGACTTGCCCGCCACCTCGGCAACGTCTATTTGCGCATCAAGGACTACTCG
CCCCATGTCGAATACCGCCAGAAGCTCAGCCAGGTGGCCAGTCTGACGGACAAGAAGCCACTGGATCATCAAGAT
GAGGCTGGTAGCACCCTCGCGCTGCGCAACCATGGCATATGGCGCAATCCGCTCTTCAGGCACCTTTTGCCTGCT
GTCGAGGAAACCAGCAGCCTGGCTCTTACCAGGGTGCTGAGTGGCCACGATGCGGCTGTTGAGATTGACTCGCCA
AAGGGGCTCTTTGTCTCTGGTGAGGTGGGCACGGGCAAGTCCATGTTGCTGGACCTCTTGGCCGATGGCCTACCA
TCACAGCGCAAGAAAAGGTGGCACTTCAACACCTTTATGCTCTACACCTTGTCTCAGCTCGACAAGCACAGGGCG
TCTCAAACCTCTGGTCAACAGCTTGAATACTCTCTGGCCTGGATGGCAAAAAAACTAGTGGACCAGTCGCCAATT
CTCTTCCTTGACGAGTTCCAGCTGCCCGACCGAGCCGCCAGTAAGATCCTGAGCCACCTCTTTATCCTCTTTTTC
CAACTCGGTGGTGTATTAGTGGCGTCTTCGAACCGGATACCAGAGGAACTGCAAAAGGCCACGGGAGTGGAATAC
GCTCCCGGACCAACTCGGGGTCTAGTGAGCAAGATGCTAGGCTCGTCTCGTTTCAAAGGCGAGCTATACGGCCAG
AGCAGCGACTTTGCCAATTTCCTCAAAGTTTTGAAGGCGAGGTGCGATTTTTGGCAGATGGACGGCACCAACGAT
TGGAGACGTAGAGAAGAGTCGATTAGCCCCGACAGCTCTCCAGCCAAGTCTACTGCAGGCTCAAGCAGCCCGACC
CCTGGATCAGATGGACATGGCGCTCGCAAGAGACCCCATCACTATCATGTCATGGGGCAAGACGACGACAATTGG
GAGCAGACGATACGTGATGCAACGTCGTGGACTGGAGCAGAAGAAAGGTGGTGGGAGCCGTCTTCAGTCGTGGTT
TATGGGCGGCGCATCTGTATTCCGCAACATCACAACGGCTTCGTGCTCTGGAAATTTGCCAAACTCGTCGAAGCT
TTTGGTCCAGCCGACTACATAACTCTGGCCTCGTCCTATCATACCTTTATTGTTGATGAGGTGCCCATCTTGACC
GTCCTGGACAAGAATGAGGCGCGTCGCTTCATCACCTTTGTCGATGCCCTGTACGAAGCACGCTGCAAGCTCGTC
ATTCGCGCCGCAAGCCCACCCGACGACCTCTTCTTCCCCAACACGCCCGGACAGCCTCCCAGGACGACCGACTCG
CAAAGTAGCGATGCCACCTACTCGGAAACAGTTGCCGAAGTCTACCAGGACCAGACGTCGCCTTTTCGCCCCAAT
ATTTCCTACTATGACTCGCCCACGGCCACGTCGCGCTACAGCCCGGATCAGGACTCCGATTTTGGTCTCGAGCGC
CCGCAGGTCGACTTTGTCAATGCTGGTACCTTTACAGGCGAAGATGAGCGCTTTGCATACAAGCGCGCTGCGTCA
CGTCTATGGGAGCTGTGTAGCGCGCGCTGGCATGCCCGCACAGGAGACTGGTGGCGGCCGCTGCCTAGCGAGGCA
AGACACTGGGAAGCTGGCCCTGTGTCGAATCCTTTACAGCCCGGGGCTGTAGCGCAAGGGACCAGCAGTGGCGAA
GGCATGGGAAAGAGTATCGAGGTGGACGAGCTGGCAGGACTCTCCAAGTGGAGGATCCAAGACCTTGAAAAGCAA
AGTCGTGGTGGTGGCTAA
Transcript >OphauB2|4971
ATGAGACGCTTCTCAACTGCGCTCACCATTACTGACCCGCTCGTCAAGTACCAGACCCTGGTCAAATCTGGCGTC
TACGCTCCCGATCAGGCCCAGCACCGACTTGCCCGCCACCTCGGCAACGTCTATTTGCGCATCAAGGACTACTCG
CCCCATGTCGAATACCGCCAGAAGCTCAGCCAGGTGGCCAGTCTGACGGACAAGAAGCCACTGGATCATCAAGAT
GAGGCTGGTAGCACCCTCGCGCTGCGCAACCATGGCATATGGCGCAATCCGCTCTTCAGGCACCTTTTGCCTGCT
GTCGAGGAAACCAGCAGCCTGGCTCTTACCAGGGTGCTGAGTGGCCACGATGCGGCTGTTGAGATTGACTCGCCA
AAGGGGCTCTTTGTCTCTGGTGAGGTGGGCACGGGCAAGTCCATGTTGCTGGACCTCTTGGCCGATGGCCTACCA
TCACAGCGCAAGAAAAGGTGGCACTTCAACACCTTTATGCTCTACACCTTGTCTCAGCTCGACAAGCACAGGGCG
TCTCAAACCTCTGGTCAACAGCTTGAATACTCTCTGGCCTGGATGGCAAAAAAACTAGTGGACCAGTCGCCAATT
CTCTTCCTTGACGAGTTCCAGCTGCCCGACCGAGCCGCCAGTAAGATCCTGAGCCACCTCTTTATCCTCTTTTTC
CAACTCGGTGGTGTATTAGTGGCGTCTTCGAACCGGATACCAGAGGAACTGCAAAAGGCCACGGGAGTGGAATAC
GCTCCCGGACCAACTCGGGGTCTAGTGAGCAAGATGCTAGGCTCGTCTCGTTTCAAAGGCGAGCTATACGGCCAG
AGCAGCGACTTTGCCAATTTCCTCAAAGTTTTGAAGGCGAGGTGCGATTTTTGGCAGATGGACGGCACCAACGAT
TGGAGACGTAGAGAAGAGTCGATTAGCCCCGACAGCTCTCCAGCCAAGTCTACTGCAGGCTCAAGCAGCCCGACC
CCTGGATCAGATGGACATGGCGCTCGCAAGAGACCCCATCACTATCATGTCATGGGGCAAGACGACGACAATTGG
GAGCAGACGATACGTGATGCAACGTCGTGGACTGGAGCAGAAGAAAGGTGGTGGGAGCCGTCTTCAGTCGTGGTT
TATGGGCGGCGCATCTGTATTCCGCAACATCACAACGGCTTCGTGCTCTGGAAATTTGCCAAACTCGTCGAAGCT
TTTGGTCCAGCCGACTACATAACTCTGGCCTCGTCCTATCATACCTTTATTGTTGATGAGGTGCCCATCTTGACC
GTCCTGGACAAGAATGAGGCGCGTCGCTTCATCACCTTTGTCGATGCCCTGTACGAAGCACGCTGCAAGCTCGTC
ATTCGCGCCGCAAGCCCACCCGACGACCTCTTCTTCCCCAACACGCCCGGACAGCCTCCCAGGACGACCGACTCG
CAAAGTAGCGATGCCACCTACTCGGAAACAGTTGCCGAAGTCTACCAGGACCAGACGTCGCCTTTTCGCCCCAAT
ATTTCCTACTATGACTCGCCCACGGCCACGTCGCGCTACAGCCCGGATCAGGACTCCGATTTTGGTCTCGAGCGC
CCGCAGGTCGACTTTGTCAATGCTGGTACCTTTACAGGCGAAGATGAGCGCTTTGCATACAAGCGCGCTGCGTCA
CGTCTATGGGAGCTGTGTAGCGCGCGCTGGCATGCCCGCACAGGAGACTGGTGGCGGCCGCTGCCTAGCGAGGCA
AGACACTGGGAAGCTGGCCCTGTGTCGAATCCTTTACAGCCCGGGGCTGTAGCGCAAGGGACCAGCAGTGGCGAA
GGCATGGGAAAGAGTATCGAGGTGGACGAGCTGGCAGGACTCTCCAAGTGGAGGATCCAAGACCTTGAAAAGCAA
AGTCGTGGTGGTGGCTAA
Gene >OphauB2|4971
ATGAGACGCTTCTCAACTGCGCTCACCATTACTGACCCGCTCGTCAAGTACCAGACCCTGGTCAAATCTGGCGTC
TACGCTCCCGATCAGGCCCAGCACCGACTTGCCCGCCACCTCGGCAACGTCTATTTGCGCATCAAGGACTACTCG
CCCCATGTCGAATACCGCCAGAAGCTCAGCCAGGTGGCCAGTCTGACGGACAAGAAGCCACTGGATCATCAAGAT
GAGGCTGGTAGCACCCTCGCGCTGCGCAACCATGGCATATGGCGCAATCCGCTCTTCAGGCACCTTTTGCCTGCT
GTCGAGGAAACCAGCAGCCTGGCTCTTACCAGGGTGCTGAGTGGCCACGATGCGGCTGTTGAGATTGACTCGCCA
AAGGGGCTCTTTGTCTCTGGTGAGGTGGGCACGGGCAAGTCCATGTTGCTGGACCTCTTGGCCGATGGCCTACCA
TCACAGCGCAAGAAAAGGTGGCACTTCAACACCTTTATGCTCTACACCTTGTCTCAGCTCGACAAGCACAGGGCG
TCTCAAACCTCTGGTCAACAGCTTGAATACTCTCTGGCCTGGATGGCAAAAAAACTAGTGGACCAGTCGCCAATT
CTCTTCCTTGACGAGTTCCAGCTGCCCGACCGAGCCGCCAGTAAGATCCTGAGCCACCTCTTTATCCTCTTTTTC
CAACTCGGTGGTGTATTAGTGGCGTCTTCGAACCGGATACCAGAGGAACTGCAAAAGGCCACGGGAGTGGAATAC
GCTCCCGGACCAACTCGGGGTCTAGTGAGCAAGATGCTAGGCTCGTCTCGTTTCAAAGGCGAGCTATACGGCCAG
AGCAGCGACTTTGCCAATTTCCTCAAAGTTTTGAAGGCGAGGTGCGATTTTTGGCAGATGGACGGCACCAACGAT
TGGAGACGTAGAGAAGAGTCGATTAGCCCCGACAGCTCTCCAGCCAAGTCTACTGCAGGCTCAAGCAGCCCGACC
CCTGGATCAGATGGACATGGCGCTCGCAAGAGACCCCATCACTATCATGTCATGGGGCAAGACGACGACAATTGG
GAGCAGACGATACGTGATGCAACGTCGTGGACTGGAGCAGAAGAAAGGTGGTGGGAGCCGTCTTCAGTCGTGGTT
TATGGGCGGCGCATCTGTATTCCGCAACATCACAACGGCTTCGTGCTCTGGAAATTTGCCAAACTCGTCGAAGCT
TTTGGTCCAGCCGACTACATAACTCTGGCCTCGTCCTATCATACCTTTATTGTTGATGAGGTGCCCATCTTGACC
GTCCTGGACAAGAATGAGGCGCGTCGCTTCATCACCTTTGTCGATGCCCTGTACGAAGCACGCTGCAAGCTCGTC
ATTCGCGCCGCAAGCCCACCCGACGACCTCTTCTTCCCCAACACGCCCGGACAGCCTCCCAGGACGACCGACTCG
CAAAGTAGCGATGCCACCTACTCGGAAACAGTTGCCGAAGTCTACCAGGACCAGACGTCGCCTTTTCGCCCCAAT
ATTTCCTACTATGACTCGCCCACGGCCACGTCGCGCTACAGCCCGGATCAGGACTCCGATTTTGGTCTCGAGCGC
CCGCAGGTCGACTTTGTCAATGCTGGTACCTTTACAGGCGAAGATGAGCGCTTTGCATACAAGCGCGCTGCGTCA
CGTCTATGGGAGCTGTGTAGCGCGCGCTGGCATGCCCGCACAGGAGACTGGTGGCGGCCGCTGCCTAGCGAGGCA
AGACACTGGGAAGCTGGCCCTGTGTCGAATCCTTTACAGCCCGGGGCTGTAGCGCAAGGGACCAGCAGTGGCGAA
GGCATGGGAAAGAGTATCGAGGTGGACGAGCTGGCAGGACTCTCCAAGTGGAGGATCCAAGACCTTGAAAAGCAA
AGTCGTGGTGGTGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail