Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4968
Gene name
LocationContig_36:4344..4727
Strand-
Gene length (bp)383
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRJ5|TAM6_SCHPO Uncharacterized protein tam6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam6 PE=2 SV=1 7 95 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 76 94 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4968
MARDQITLQSLQKPEDLQGLLRHDGDESCLSCKIVGSGAFFALGIYSYVSGMSQLEKQRNVIAQSKSMFGIKSRK
FGIVGISLGLAWMGLWRAFR*
Coding >OphauB2|4968
ATGGCACGCGACCAAATCACGCTGCAGTCGCTACAGAAGCCCGAAGACCTACAGGGTCTGCTGCGCCATGATGGA
GACGAAAGTTGCCTCAGCTGCAAGATCGTAGGCAGCGGCGCATTCTTCGCCCTCGGAATCTACAGCTATGTTTCT
GGCATGTCACAGCTTGAGAAACAGCGAAACGTCATCGCCCAGAGCAAATCCATGTTTGGCATCAAGAGCCGCAAA
TTCGGAATCGTGGGTATTTCGCTGGGTTTGGCCTGGATGGGTCTCTGGAGAGCTTTTCGCTGA
Transcript >OphauB2|4968
ATGGCACGCGACCAAATCACGCTGCAGTCGCTACAGAAGCCCGAAGACCTACAGGGTCTGCTGCGCCATGATGGA
GACGAAAGTTGCCTCAGCTGCAAGATCGTAGGCAGCGGCGCATTCTTCGCCCTCGGAATCTACAGCTATGTTTCT
GGCATGTCACAGCTTGAGAAACAGCGAAACGTCATCGCCCAGAGCAAATCCATGTTTGGCATCAAGAGCCGCAAA
TTCGGAATCGTGGGTATTTCGCTGGGTTTGGCCTGGATGGGTCTCTGGAGAGCTTTTCGCTGA
Gene >OphauB2|4968
ATGGCACGCGACCAAATCACGCTGCAGTCGCTACAGAAGCCCGAAGACCTACAGGGTCTGCTGCGCCATGATGGA
GACGAAAGTTGCCTCAGCTGCAAGATCGTAGGTGCGCAAGCCGTCCACCACGGAGCAAAAAGCCATCCACTTGTT
GTCGCGCAGGATAGCATTAGTACTACTCTTTTGCACTAACACGTCCAATAGGCAGCGGCGCATTCTTCGCCCTCG
GAATCTACAGCTATGTTTCTGGCATGTCACAGCTTGAGAAACAGCGAAACGTCATCGCCCAGAGCAAATCCATGT
TTGGCATCAAGAGCCGCAAATTCGGAATCGTGGGTATTTCGCTGGGTTTGGCCTGGATGGGTCTCTGGAGAGCTT
TTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail