Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4961
Gene name
LocationContig_356:1440..2943
Strand+
Gene length (bp)1503
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00246 Peptidase_M14 Zinc carboxypeptidase 4.6E-68 148 448

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7EUC0|ECM14_SCLS1 Putative metallocarboxypeptidase ecm14 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ecm14 PE=3 SV=1 45 467 1.0E-159
sp|E5A0U8|ECM14_LEPMJ Putative metallocarboxypeptidase ECM14 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=ECM14 PE=3 SV=1 45 463 3.0E-153
sp|A6RCF5|ECM14_AJECN Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ECM14 PE=3 SV=1 27 462 6.0E-147
sp|C1GDH9|ECM14_PARBD Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides brasiliensis (strain Pb18) GN=ECM14 PE=3 SV=1 25 464 9.0E-146
sp|C1HE31|ECM14_PARBA Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=ECM14 PE=3 SV=1 42 464 2.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7EUC0|ECM14_SCLS1 Putative metallocarboxypeptidase ecm14 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ecm14 PE=3 SV=1 45 467 1.0E-159
sp|E5A0U8|ECM14_LEPMJ Putative metallocarboxypeptidase ECM14 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=ECM14 PE=3 SV=1 45 463 3.0E-153
sp|A6RCF5|ECM14_AJECN Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ECM14 PE=3 SV=1 27 462 6.0E-147
sp|C1GDH9|ECM14_PARBD Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides brasiliensis (strain Pb18) GN=ECM14 PE=3 SV=1 25 464 9.0E-146
sp|C1HE31|ECM14_PARBA Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=ECM14 PE=3 SV=1 42 464 2.0E-145
sp|C0NM08|ECM14_AJECG Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=ECM14 PE=3 SV=1 27 462 4.0E-145
sp|C5JZS0|ECM14_AJEDS Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain SLH14081) GN=ECM14 PE=3 SV=1 45 465 4.0E-145
sp|C6H4F1|ECM14_AJECH Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain H143) GN=ECM14 PE=3 SV=1 27 462 5.0E-145
sp|C0SAI5|ECM14_PARBP Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides brasiliensis (strain Pb03) GN=ECM14 PE=3 SV=1 42 464 3.0E-144
sp|C5G6U8|ECM14_AJEDR Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=ECM14 PE=3 SV=1 45 465 1.0E-143
sp|B8M2K0|ECM14_TALSN Putative metallocarboxypeptidase ecm14 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=ecm14 PE=3 SV=1 45 462 1.0E-138
sp|C4JEE1|ECM14_UNCRE Putative metallocarboxypeptidase ECM14 OS=Uncinocarpus reesii (strain UAMH 1704) GN=ECM14 PE=3 SV=1 42 460 2.0E-137
sp|A1CSU3|ECM14_ASPCL Putative metallocarboxypeptidase ecm14 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ecm14 PE=3 SV=1 45 461 2.0E-137
sp|A2QZA2|ECM14_ASPNC Putative metallocarboxypeptidase ecm14 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ecm14 PE=3 SV=1 40 465 2.0E-136
sp|B6H233|ECM14_PENRW Putative metallocarboxypeptidase ecm14 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=ecm14 PE=3 SV=1 45 477 2.0E-136
sp|Q2TZK2|ECM14_ASPOR Putative metallocarboxypeptidase ecm14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ecm14 PE=3 SV=1 40 459 2.0E-136
sp|B8NBP9|ECM14_ASPFN Putative metallocarboxypeptidase ecm14 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ecm14 PE=3 SV=1 40 459 2.0E-136
sp|Q0C9B4|ECM14_ASPTN Putative metallocarboxypeptidase ecm14 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ecm14 PE=3 SV=1 45 462 1.0E-133
sp|D4DIW7|ECM14_TRIVH Putative metallocarboxypeptidase ECM14 OS=Trichophyton verrucosum (strain HKI 0517) GN=ECM14 PE=3 SV=1 45 487 2.0E-133
sp|B6Q972|ECM14_TALMQ Putative metallocarboxypeptidase ecm14 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=ecm14 PE=3 SV=1 45 465 7.0E-133
sp|D4AKU7|ECM14_ARTBC Putative metallocarboxypeptidase ECM14 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ECM14 PE=3 SV=1 45 487 3.0E-132
sp|E4UPZ6|ECM14_ARTGP Putative metallocarboxypeptidase ECM14 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=ECM14 PE=3 SV=1 45 459 1.0E-131
sp|A1DGH9|ECM14_NEOFI Putative metallocarboxypeptidase ecm14 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ecm14 PE=3 SV=1 45 461 3.0E-131
sp|C5PHW9|ECM14_COCP7 Putative metallocarboxypeptidase ECM14 OS=Coccidioides posadasii (strain C735) GN=ECM14 PE=3 SV=1 42 460 2.0E-130
sp|Q5B011|ECM14_EMENI Putative metallocarboxypeptidase ecm14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ecm14 PE=3 SV=2 30 492 4.0E-130
sp|Q4X1U0|ECM14_ASPFU Putative metallocarboxypeptidase ecm14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ecm14 PE=3 SV=1 45 461 8.0E-130
sp|B0XRS8|ECM14_ASPFC Putative metallocarboxypeptidase ecm14 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ecm14 PE=3 SV=1 45 461 8.0E-130
sp|E9DD69|ECM14_COCPS Putative metallocarboxypeptidase ECM14 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=ECM14 PE=3 SV=1 42 460 1.0E-129
sp|C5FPR9|ECM14_ARTOC Putative metallocarboxypeptidase ECM14 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=ECM14 PE=3 SV=1 45 466 3.0E-126
sp|P38836|ECM14_YEAST Putative metallocarboxypeptidase ECM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM14 PE=1 SV=1 50 459 1.0E-94
sp|O74818|YBJ7_SCHPO Uncharacterized carboxypeptidase C337.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.07c PE=3 SV=1 39 458 8.0E-77
sp|B6V865|MCPA_TRITO Metallocarboxypeptidase A OS=Trichophyton tonsurans GN=MCPA PE=3 SV=1 135 448 1.0E-52
sp|B8XGR3|MCPA_TRIEQ Metallocarboxypeptidase A OS=Trichophyton equinum GN=MCPA PE=3 SV=1 135 448 2.0E-52
sp|D4D675|MCPAL_TRIVH Metallocarboxypeptidase A-like protein TRV_02598 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02598 PE=3 SV=1 69 454 1.0E-50
sp|D4B5N0|MCPAL_ARTBC Metallocarboxypeptidase A-like protein ARB_03789 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03789 PE=3 SV=1 134 454 2.0E-50
sp|C5FVN6|MCPA_ARTOC Metallocarboxypeptidase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCPA PE=3 SV=1 135 448 3.0E-50
sp|P09955|CBPB1_PIG Carboxypeptidase B OS=Sus scrofa GN=CPB1 PE=1 SV=5 17 460 3.0E-50
sp|D4DL57|MCPA_TRIVH Probable metallocarboxypeptidase A OS=Trichophyton verrucosum (strain HKI 0517) GN=MCPA PE=3 SV=1 135 448 3.0E-50
sp|D4AS12|MCPA_ARTBC Probable metallocarboxypeptidase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MCPA PE=1 SV=2 135 448 3.0E-50
sp|A6XGK3|MCPA_TRIRU Metallocarboxypeptidase A OS=Trichophyton rubrum GN=MCPA PE=1 SV=1 135 448 3.0E-50
sp|Q504N0|CBPA2_MOUSE Carboxypeptidase A2 OS=Mus musculus GN=Cpa2 PE=1 SV=1 46 454 1.0E-49
sp|C5FH26|MCPAL_ARTOC Metallocarboxypeptidase A-like protein MCYG_01475 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01475 PE=3 SV=1 6 454 2.0E-49
sp|P00732|CBPB1_BOVIN Carboxypeptidase B OS=Bos taurus GN=CPB1 PE=1 SV=2 17 459 4.0E-49
sp|P19222|CBPA2_RAT Carboxypeptidase A2 OS=Rattus norvegicus GN=Cpa2 PE=1 SV=1 46 454 8.0E-49
sp|Q9JHH6|CBPB2_MOUSE Carboxypeptidase B2 OS=Mus musculus GN=Cpb2 PE=1 SV=1 107 451 7.0E-48
sp|P15088|CBPA3_HUMAN Mast cell carboxypeptidase A OS=Homo sapiens GN=CPA3 PE=1 SV=2 48 459 2.0E-47
sp|Q2KIG3|CBPB2_BOVIN Carboxypeptidase B2 OS=Bos taurus GN=CPB2 PE=1 SV=1 107 461 3.0E-47
sp|P15086|CBPB1_HUMAN Carboxypeptidase B OS=Homo sapiens GN=CPB1 PE=1 SV=4 17 459 4.0E-47
sp|P19223|CBPB1_RAT Carboxypeptidase B OS=Rattus norvegicus GN=Cpb1 PE=1 SV=1 107 458 8.0E-47
sp|Q9EQV9|CBPB2_RAT Carboxypeptidase B2 OS=Rattus norvegicus GN=Cpb2 PE=2 SV=1 107 462 1.0E-46
sp|P48052|CBPA2_HUMAN Carboxypeptidase A2 OS=Homo sapiens GN=CPA2 PE=1 SV=3 46 452 2.0E-46
sp|Q6P8K8|CBPA4_MOUSE Carboxypeptidase A4 OS=Mus musculus GN=Cpa4 PE=2 SV=2 70 454 2.0E-46
sp|P15089|CBPA3_MOUSE Mast cell carboxypeptidase A OS=Mus musculus GN=Cpa3 PE=2 SV=1 13 463 6.0E-46
sp|P04069|CBPB_ASTAS Carboxypeptidase B OS=Astacus astacus PE=1 SV=1 135 458 9.0E-46
sp|Q96IY4|CBPB2_HUMAN Carboxypeptidase B2 OS=Homo sapiens GN=CPB2 PE=1 SV=2 108 461 1.0E-45
sp|P21961|CBPA3_RAT Mast cell carboxypeptidase A (Fragment) OS=Rattus norvegicus GN=Cpa3 PE=1 SV=2 48 459 6.0E-45
sp|O02350|CBPA1_ANOGA Zinc carboxypeptidase A 1 OS=Anopheles gambiae GN=AGAP009593 PE=2 SV=3 139 451 9.0E-44
sp|Q9UI42|CBPA4_HUMAN Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 SV=2 106 461 2.0E-43
sp|P42788|CBPZ_SIMVI Zinc carboxypeptidase (Fragment) OS=Simulium vittatum PE=2 SV=1 142 451 1.0E-42
sp|P00730|CBPA1_BOVIN Carboxypeptidase A1 OS=Bos taurus GN=CPA1 PE=1 SV=3 47 461 3.0E-42
sp|Q8R4H4|CBPA5_MOUSE Carboxypeptidase A5 OS=Mus musculus GN=Cpa5 PE=2 SV=1 47 454 4.0E-42
sp|P55261|CBPB1_CANLF Carboxypeptidase B OS=Canis lupus familiaris GN=CPB1 PE=2 SV=1 107 459 5.0E-42
sp|P00731|CBPA1_RAT Carboxypeptidase A1 OS=Rattus norvegicus GN=Cpa1 PE=2 SV=2 47 447 2.0E-40
sp|Q8IVL8|CBPO_HUMAN Carboxypeptidase O OS=Homo sapiens GN=CPO PE=2 SV=1 139 451 2.0E-40
sp|P09954|CBPA1_PIG Carboxypeptidase A1 OS=Sus scrofa GN=CPA1 PE=1 SV=2 47 447 1.0E-39
sp|Q5U901|CBPA6_MOUSE Carboxypeptidase A6 OS=Mus musculus GN=Cpa6 PE=2 SV=1 45 459 2.0E-39
sp|Q0II73|CBPO_BOVIN Carboxypeptidase O OS=Bos taurus GN=CPO PE=2 SV=1 139 451 2.0E-39
sp|P15085|CBPA1_HUMAN Carboxypeptidase A1 OS=Homo sapiens GN=CPA1 PE=1 SV=2 47 447 1.0E-38
sp|Q8N4T0|CBPA6_HUMAN Carboxypeptidase A6 OS=Homo sapiens GN=CPA6 PE=1 SV=2 14 459 3.0E-38
sp|Q7TPZ8|CBPA1_MOUSE Carboxypeptidase A1 OS=Mus musculus GN=Cpa1 PE=1 SV=1 47 447 4.0E-38
sp|Q8WXQ8|CBPA5_HUMAN Carboxypeptidase A5 OS=Homo sapiens GN=CPA5 PE=2 SV=1 73 461 4.0E-35
sp|Q4R7R2|CBPA5_MACFA Carboxypeptidase A5 OS=Macaca fascicularis GN=CPA5 PE=2 SV=1 163 461 1.0E-34
sp|Q9VL86|CBPA1_DROME Zinc carboxypeptidase A 1 OS=Drosophila melanogaster GN=CG17633 PE=2 SV=1 151 451 3.0E-33
sp|Q29NC4|CBPA1_DROPS Zinc carboxypeptidase A 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14587 PE=3 SV=1 151 451 1.0E-30
sp|P29068|CBPT_THEVU Carboxypeptidase T OS=Thermoactinomyces vulgaris GN=cpt PE=1 SV=1 112 456 1.0E-20
sp|P18143|CBPS_STRGR Zinc carboxypeptidase OS=Streptomyces griseus GN=scpD PE=1 SV=2 157 451 2.0E-19
sp|P39041|CBPS_STRMP Zinc carboxypeptidase OS=Saccharothrix mutabilis subsp. capreolus PE=3 SV=1 160 450 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0004181 metallocarboxypeptidase activity Yes
GO:0008270 zinc ion binding Yes
GO:0006508 proteolysis Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0046914 transition metal ion binding No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0008235 metalloexopeptidase activity No
GO:0043167 ion binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004180 carboxypeptidase activity No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0043169 cation binding No
GO:0008238 exopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4961
MNKISMLARLLLLSLLLLSLLLLLLLQCPPIHHGLSWPWPSRLSHGGQVVLRFTTTSPALQTALLDAAAHLALDV
WAKTPHHIDVRLRKNQVESLCHAVPHSLCAEYSVLIPDVAAAIARSLARTTLDTQIVTADHVFFQDYQPISVIDR
WMRLVEAMFPSHVEYISIAKSFEARDIAALRVGAIHARQKDWSHGPRKTILVTGSLHAREWIATTTVNYLAWSLM
NSFGKESFITKLLQEFDFVFIPVVNPDGVDYSWKVDRLWRKSRQPTSLPFCRGFDLDHAFGYGWNSSHVQSDACS
EEYPGDKPFEAVEAMQLAAWARNQSLSGQAAFIGLVDLHAYSQQILFPFSYSCSAEPPNLENLEEVAAGMAKAIR
LSNGEIYSASSACPAALAPVTEKPFAPGGGSALDWFYHELGAHFSYQIKLRDTGSYGFLLPREQIVPTGQEALDA
IKYLGDFLLGNNGIEKAARNNVAKTTPYSNKDGNRDQMASQELRRLRMRT*
Coding >OphauB2|4961
ATGAACAAAATCTCCATGCTCGCCAGGCTGCTCTTATTGTCGTTGCTGCTGCTGTCGCTGTTGCTTCTACTGCTG
CTTCAGTGCCCTCCCATTCATCATGGTCTCTCGTGGCCTTGGCCGTCTCGCCTCAGCCATGGCGGCCAAGTTGTG
CTGCGCTTCACCACCACCTCGCCTGCTCTACAGACGGCCCTTCTAGATGCAGCCGCTCATCTCGCCCTCGACGTC
TGGGCCAAGACGCCTCACCACATTGATGTCCGCCTCCGTAAAAACCAGGTCGAGTCTCTCTGTCACGCTGTACCC
CACTCACTATGCGCAGAGTATTCAGTCCTTATTCCAGACGTTGCCGCCGCCATTGCTCGCTCTCTTGCTCGCACA
ACCCTGGATACTCAAATAGTTACCGCCGACCATGTCTTCTTCCAAGACTACCAGCCTATTTCTGTCATTGACCGC
TGGATGCGCCTCGTCGAGGCCATGTTTCCTTCGCACGTCGAGTACATATCCATAGCCAAGTCCTTTGAGGCCAGA
GACATTGCCGCTTTGCGCGTCGGGGCAATCCATGCCCGTCAAAAGGATTGGTCCCATGGCCCGAGGAAAACAATC
CTTGTCACTGGCAGCCTCCACGCCAGGGAATGGATTGCCACAACTACTGTCAATTACTTGGCTTGGTCCCTCATG
AATTCCTTTGGCAAAGAGAGCTTCATAACCAAGCTACTGCAAGAGTTTGACTTTGTCTTTATACCCGTTGTCAAC
CCAGACGGTGTAGACTACTCCTGGAAGGTTGACCGGTTGTGGCGCAAGTCGAGACAACCCACTAGCCTTCCATTT
TGTCGGGGCTTCGACCTCGACCACGCCTTTGGCTATGGCTGGAACAGTTCGCATGTCCAGAGCGATGCCTGTTCC
GAAGAATATCCTGGCGACAAACCGTTTGAGGCTGTTGAGGCCATGCAACTTGCCGCTTGGGCTCGTAATCAGTCG
CTCAGCGGCCAGGCCGCTTTTATCGGTCTTGTCGATCTGCACGCATACTCGCAGCAGATTTTATTTCCCTTCTCC
TACTCTTGCTCAGCTGAGCCCCCGAATCTTGAAAACCTCGAGGAAGTGGCTGCTGGCATGGCAAAGGCTATTCGA
TTGTCCAATGGCGAAATATACTCTGCTTCTTCGGCGTGTCCAGCTGCTTTGGCGCCTGTTACGGAGAAGCCCTTT
GCGCCGGGTGGCGGCTCCGCTCTCGACTGGTTCTACCACGAGCTTGGGGCGCATTTCAGCTATCAAATCAAGCTC
CGGGATACTGGCAGCTACGGCTTCCTTTTACCGAGAGAGCAAATTGTCCCCACGGGCCAAGAAGCTTTGGATGCC
ATCAAGTATCTTGGTGACTTTCTTCTAGGCAATAACGGCATCGAAAAAGCAGCACGAAACAATGTTGCCAAGACG
ACCCCATATTCTAACAAAGATGGCAACCGAGACCAAATGGCAAGCCAGGAGCTGCGCCGGCTTAGGATGCGCACA
TGA
Transcript >OphauB2|4961
ATGAACAAAATCTCCATGCTCGCCAGGCTGCTCTTATTGTCGTTGCTGCTGCTGTCGCTGTTGCTTCTACTGCTG
CTTCAGTGCCCTCCCATTCATCATGGTCTCTCGTGGCCTTGGCCGTCTCGCCTCAGCCATGGCGGCCAAGTTGTG
CTGCGCTTCACCACCACCTCGCCTGCTCTACAGACGGCCCTTCTAGATGCAGCCGCTCATCTCGCCCTCGACGTC
TGGGCCAAGACGCCTCACCACATTGATGTCCGCCTCCGTAAAAACCAGGTCGAGTCTCTCTGTCACGCTGTACCC
CACTCACTATGCGCAGAGTATTCAGTCCTTATTCCAGACGTTGCCGCCGCCATTGCTCGCTCTCTTGCTCGCACA
ACCCTGGATACTCAAATAGTTACCGCCGACCATGTCTTCTTCCAAGACTACCAGCCTATTTCTGTCATTGACCGC
TGGATGCGCCTCGTCGAGGCCATGTTTCCTTCGCACGTCGAGTACATATCCATAGCCAAGTCCTTTGAGGCCAGA
GACATTGCCGCTTTGCGCGTCGGGGCAATCCATGCCCGTCAAAAGGATTGGTCCCATGGCCCGAGGAAAACAATC
CTTGTCACTGGCAGCCTCCACGCCAGGGAATGGATTGCCACAACTACTGTCAATTACTTGGCTTGGTCCCTCATG
AATTCCTTTGGCAAAGAGAGCTTCATAACCAAGCTACTGCAAGAGTTTGACTTTGTCTTTATACCCGTTGTCAAC
CCAGACGGTGTAGACTACTCCTGGAAGGTTGACCGGTTGTGGCGCAAGTCGAGACAACCCACTAGCCTTCCATTT
TGTCGGGGCTTCGACCTCGACCACGCCTTTGGCTATGGCTGGAACAGTTCGCATGTCCAGAGCGATGCCTGTTCC
GAAGAATATCCTGGCGACAAACCGTTTGAGGCTGTTGAGGCCATGCAACTTGCCGCTTGGGCTCGTAATCAGTCG
CTCAGCGGCCAGGCCGCTTTTATCGGTCTTGTCGATCTGCACGCATACTCGCAGCAGATTTTATTTCCCTTCTCC
TACTCTTGCTCAGCTGAGCCCCCGAATCTTGAAAACCTCGAGGAAGTGGCTGCTGGCATGGCAAAGGCTATTCGA
TTGTCCAATGGCGAAATATACTCTGCTTCTTCGGCGTGTCCAGCTGCTTTGGCGCCTGTTACGGAGAAGCCCTTT
GCGCCGGGTGGCGGCTCCGCTCTCGACTGGTTCTACCACGAGCTTGGGGCGCATTTCAGCTATCAAATCAAGCTC
CGGGATACTGGCAGCTACGGCTTCCTTTTACCGAGAGAGCAAATTGTCCCCACGGGCCAAGAAGCTTTGGATGCC
ATCAAGTATCTTGGTGACTTTCTTCTAGGCAATAACGGCATCGAAAAAGCAGCACGAAACAATGTTGCCAAGACG
ACCCCATATTCTAACAAAGATGGCAACCGAGACCAAATGGCAAGCCAGGAGCTGCGCCGGCTTAGGATGCGCACA
TGA
Gene >OphauB2|4961
ATGAACAAAATCTCCATGCTCGCCAGGCTGCTCTTATTGTCGTTGCTGCTGCTGTCGCTGTTGCTTCTACTGCTG
CTTCAGTGCCCTCCCATTCATCATGGTCTCTCGTGGCCTTGGCCGTCTCGCCTCAGCCATGGCGGCCAAGTTGTG
CTGCGCTTCACCACCACCTCGCCTGCTCTACAGACGGCCCTTCTAGATGCAGCCGCTCATCTCGCCCTCGACGTC
TGGGCCAAGACGCCTCACCACATTGATGTCCGCCTCCGTAAAAACCAGGTCGAGTCTCTCTGTCACGCTGTACCC
CACTCACTATGCGCAGAGTATTCAGTCCTTATTCCAGACGTTGCCGCCGCCATTGCTCGCTCTCTTGCTCGCACA
ACCCTGGATACTCAAATAGTTACCGCCGACCATGTCTTCTTCCAAGACTACCAGCCTATTTCTGTCATTGACCGC
TGGATGCGCCTCGTCGAGGCCATGTTTCCTTCGCACGTCGAGTACATATCCATAGCCAAGTCCTTTGAGGCCAGA
GACATTGCCGCTTTGCGCGTCGGGGCAATCCATGCCCGTCAAAAGGATTGGTCCCATGGCCCGAGGAAAACAATC
CTTGTCACTGGCAGCCTCCACGCCAGGGAATGGATTGCCACAACTACTGTCAATTACTTGGCTTGGTCCCTCATG
AATTCCTTTGGCAAAGAGAGCTTCATAACCAAGCTACTGCAAGAGTTTGACTTTGTCTTTATACCCGTTGTCAAC
CCAGACGGTGTAGACTACTCCTGGAAGGTTGACCGGTTGTGGCGCAAGTCGAGACAACCCACTAGCCTTCCATTT
TGTCGGGGCTTCGACCTCGACCACGCCTTTGGCTATGGCTGGAACAGTTCGCATGTCCAGAGCGATGCCTGTTCC
GAAGAATATCCTGGCGACAAACCGTTTGAGGCTGTTGAGGCCATGCAACTTGCCGCTTGGGCTCGTAATCAGTCG
CTCAGCGGCCAGGCCGCTTTTATCGGTCTTGTCGATCTGCACGCATACTCGCAGCAGATTTTATTTCCCTTCTCC
TACTCTTGCTCAGCTGAGCCCCCGAATCTTGAAAACCTCGAGGAAGTGGCTGCTGGCATGGCAAAGGCTATTCGA
TTGTCCAATGGCGAAATATACTCTGCTTCTTCGGCGTGTCCAGCTGCTTTGGCGCCTGTTACGGAGAAGCCCTTT
GCGCCGGGTGGCGGCTCCGCTCTCGACTGGTTCTACCACGAGCTTGGGGCGCATTTCAGCTATCAAATCAAGCTC
CGGGATACTGGCAGCTACGGCTTCCTTTTACCGAGAGAGCAAATTGTCCCCACGGGCCAAGAAGCTTTGGATGCC
ATCAAGTATCTTGGTGACTTTCTTCTAGGCAATAACGGCATCGAAAAAGCAGCACGAAACAATGTTGCCAAGACG
ACCCCATATTCTAACAAAGATGGCAACCGAGACCAAATGGCAAGCCAGGAGCTGCGCCGGCTTAGGATGCGCACA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail