Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4960
Gene name
LocationContig_354:1574..4933
Strand-
Gene length (bp)3359
Transcript length (bp)3069
Coding sequence length (bp)3069
Protein length (aa) 1023

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04987 PigN Phosphatidylinositolglycan class N (PIG-N) 4.7E-157 453 931
PF00884 Sulfatase Sulfatase 1.6E-08 234 319
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 3.2E-06 101 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SAP1|MCD4_NEUCR GPI ethanolamine phosphate transferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcd-4 PE=3 SV=1 7 984 0.0E+00
sp|O95427|PIGN_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens GN=PIGN PE=1 SV=1 13 962 0.0E+00
sp|Q9R1S3|PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus GN=Pign PE=2 SV=2 13 962 0.0E+00
sp|Q5AXD1|MCD4_EMENI GPI ethanolamine phosphate transferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcd4 PE=3 SV=1 10 566 0.0E+00
sp|Q8WZK2|MCD4_SCHPO GPI ethanolamine phosphate transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its8 PE=1 SV=1 14 966 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SAP1|MCD4_NEUCR GPI ethanolamine phosphate transferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcd-4 PE=3 SV=1 7 984 0.0E+00
sp|O95427|PIGN_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens GN=PIGN PE=1 SV=1 13 962 0.0E+00
sp|Q9R1S3|PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus GN=Pign PE=2 SV=2 13 962 0.0E+00
sp|Q5AXD1|MCD4_EMENI GPI ethanolamine phosphate transferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcd4 PE=3 SV=1 10 566 0.0E+00
sp|Q8WZK2|MCD4_SCHPO GPI ethanolamine phosphate transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its8 PE=1 SV=1 14 966 0.0E+00
sp|Q6BWE3|MCD4_DEBHA GPI ethanolamine phosphate transferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCD4 PE=3 SV=2 9 982 0.0E+00
sp|P36051|MCD4_YEAST GPI ethanolamine phosphate transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCD4 PE=1 SV=1 9 969 0.0E+00
sp|Q6CW36|MCD4_KLULA GPI ethanolamine phosphate transferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCD4 PE=3 SV=1 10 968 0.0E+00
sp|Q757X5|MCD4_ASHGO GPI ethanolamine phosphate transferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCD4 PE=3 SV=2 10 987 0.0E+00
sp|Q4ILH3|MCD4_GIBZE GPI ethanolamine phosphate transferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCD4 PE=3 SV=1 9 969 0.0E+00
sp|Q2U0S9|MCD4_ASPOR GPI ethanolamine phosphate transferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mcd4 PE=3 SV=1 8 1018 0.0E+00
sp|Q2H0X9|MCD4_CHAGB GPI ethanolamine phosphate transferase 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MCD4 PE=3 SV=1 118 983 0.0E+00
sp|Q4W9R7|MCD4_ASPFU GPI ethanolamine phosphate transferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mcd4 PE=2 SV=1 10 968 0.0E+00
sp|Q6C0Z3|MCD4_YARLI GPI ethanolamine phosphate transferase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCD4 PE=3 SV=1 14 968 0.0E+00
sp|Q5A3M6|MCD4_CANAL GPI ethanolamine phosphate transferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCD4 PE=3 SV=1 9 971 0.0E+00
sp|Q6FJ81|MCD4_CANGA GPI ethanolamine phosphate transferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCD4 PE=3 SV=1 9 966 0.0E+00
sp|Q5AXD1|MCD4_EMENI GPI ethanolamine phosphate transferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcd4 PE=3 SV=1 638 968 1.0E-106
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 174 395 1.0E-09
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 189 365 1.0E-09
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 50 367 2.0E-09
sp|Q09782|GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las21 PE=3 SV=1 45 386 5.0E-09
sp|P40367|GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS21 PE=1 SV=1 230 365 3.0E-08
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 221 422 3.0E-07
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 189 397 2.0E-06
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 174 395 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016740 transferase activity Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0009247 glycolipid biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0006664 glycolipid metabolic process No
GO:0006497 protein lipidation No
GO:0046474 glycerophospholipid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0046467 membrane lipid biosynthetic process No
GO:0016020 membrane No
GO:0090407 organophosphate biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008610 lipid biosynthetic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0008152 metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0006629 lipid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0031090 organelle membrane No
GO:0006643 membrane lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008654 phospholipid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0003824 catalytic activity No
GO:0046488 phosphatidylinositol metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 469 491 22
3 504 526 22
4 556 578 22
5 591 610 19
6 615 637 22
7 644 666 22
8 694 716 22
9 729 748 19
10 768 790 22
11 833 855 22
12 875 897 22
13 904 926 22
14 941 963 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4960
MAAAAGAVTRAGFLITAVVFHAVYIMSIFDIYFVSPIVSGMKLVGIERASTVKPPADRLVLVVGDGLRADKAFQW
AAEPYGESEEDLVPRPLAPFLRSRVLEHGTFGVSHTRVPTESRPGHVALIAGLYEDVSAVATGWKLNPVDFDSVF
NRSRHTWSWGSPDILPMFERGAVPGRVDALTYEPDFEDFSQDATRLDYWVFDHVKDFFAQAASNQSLAQALRQDR
SIFFLHLLGLDTSGHAYRPYSNEYLYNIKVVDEGVAQVTDLFNSFFGDDRTAFVFTADHGMSDWGSHGDGHPDNT
RTPLIVWGSGVARPEIHNDVIAPGHDEFSADWHLQHVRRHDVAQADVAALMAYLIGTEFPANSVGKLPLSYLSAD
SRDKASAFLANAQSMLEMYRVKEDIKRANQIRFVPYPPLSESVAPPAQRLAAIRHLIESEKLDEAVEETDALITI
TLEGLRYLQTYDWLFLRALITAGYLGWMVYATITVFDLFLLQQPVAPQRTLGSVTLFSSLFAAMVASFIVSHSPL
TYYAYATFPVLFWEQVYTRRNSLVLGCRALFWHVQSAGAWLTVALHTVFYVAVIQCMALGYIHRQVFTAIFVLWA
LWPCTYGMSFVQQHALLSAAWAVACLAMSIFTLLPAIKVENVPLILAGGTIMAAAGIVYLLFDQFAPSGSSHYMS
KSSGPRLVSTMNHSIRRTLVGAQIGLILLAMAVTRSSALSLQKKQGLPHGNQIVGWIVLVVSLLLPLAYRLEAKT
HYTHRLAVVSLMFAPTFIILTISYEALFYIAFCSILFLWLRLEYAAQRFLDGQQAAETIASRPDEYVRPAQSPRP
LQLSDARVALFFMVFLQSAFFSTGNVASVSSFSLDSVYRLIPIFDPISQGALLVLKLMIPFVLISAYLGVLNKRL
GVAPSALFMVVMAVSDILTLYFFWVVKDEGSWLEIGSTISHFAIASILCVFVAGLEGVSAVLIAGVNLEHDNGDN
GGKGAVSESPSRTGCAELKHANGQVLGHRQDGRTSRHDANNVGNRSM*
Coding >OphauB2|4960
ATGGCGGCGGCAGCTGGCGCAGTCACTCGCGCCGGCTTTCTAATAACAGCCGTCGTGTTCCATGCCGTCTATATA
ATGTCTATTTTCGACATTTATTTTGTCAGTCCAATTGTTTCTGGAATGAAACTGGTTGGCATTGAGCGCGCCAGC
ACAGTCAAGCCTCCTGCCGACCGACTTGTCCTCGTTGTTGGCGACGGTCTCCGGGCTGACAAGGCGTTTCAATGG
GCTGCAGAGCCATATGGCGAGTCGGAGGAGGATCTGGTGCCACGCCCGCTGGCGCCCTTTCTTCGATCACGCGTG
CTCGAGCACGGTACCTTTGGTGTATCTCACACACGCGTACCGACCGAATCGCGGCCCGGTCATGTCGCCCTTATT
GCAGGCCTCTACGAGGATGTGTCGGCCGTGGCGACTGGCTGGAAGCTTAATCCAGTTGACTTCGACAGTGTTTTC
AACCGCAGTCGCCATACGTGGAGCTGGGGCAGCCCCGACATTCTGCCCATGTTTGAACGAGGCGCCGTGCCTGGC
CGAGTCGATGCTCTGACTTATGAGCCTGATTTTGAAGACTTTTCGCAAGACGCCACTCGCCTAGACTACTGGGTC
TTTGACCACGTCAAGGATTTTTTTGCACAGGCTGCCTCGAACCAAAGCCTTGCCCAGGCCCTGCGCCAGGACCGC
TCCATCTTCTTTCTCCATTTGCTAGGGCTCGATACATCAGGACACGCCTACAGACCCTATTCCAACGAGTACCTA
TACAACATCAAGGTGGTCGATGAGGGTGTAGCGCAAGTAACAGACCTATTCAACAGCTTTTTTGGTGATGACAGG
ACAGCTTTTGTCTTTACCGCTGACCACGGCATGAGCGATTGGGGCAGCCACGGCGATGGTCATCCTGATAATACA
CGTACCCCTCTAATTGTATGGGGCTCGGGTGTTGCCCGTCCTGAAATCCACAACGACGTGATTGCTCCAGGCCAC
GATGAATTTTCTGCCGACTGGCACCTGCAACATGTTCGCCGCCACGATGTTGCACAAGCCGACGTAGCCGCTCTC
ATGGCATATCTAATTGGAACCGAATTCCCGGCCAATTCGGTCGGCAAACTGCCCCTCTCATATCTCTCTGCTGAT
AGCCGCGACAAAGCCTCAGCTTTTTTGGCCAATGCCCAGAGTATGCTCGAAATGTATCGTGTCAAGGAGGATATC
AAGAGGGCGAACCAAATCCGCTTCGTTCCTTACCCGCCCCTGAGCGAAAGTGTCGCCCCACCTGCTCAGCGATTG
GCCGCTATTCGTCACCTCATAGAGTCTGAAAAGCTTGACGAGGCCGTCGAGGAGACGGATGCCCTCATCACTATT
ACCCTAGAGGGGCTGCGCTATCTTCAGACATACGACTGGCTTTTCCTCCGTGCTCTCATTACAGCTGGGTACCTG
GGCTGGATGGTGTATGCCACAATTACCGTATTCGATCTATTTCTGCTACAACAGCCTGTGGCGCCACAGCGAACC
CTTGGCAGTGTCACCCTGTTTTCCTCATTATTTGCTGCAATGGTGGCCTCTTTCATCGTGTCTCACTCTCCACTG
ACTTACTACGCCTATGCCACCTTTCCAGTCTTGTTTTGGGAACAGGTGTATACTCGCCGCAACAGCCTGGTCCTG
GGATGCCGCGCCTTGTTTTGGCACGTCCAGTCTGCAGGGGCTTGGTTGACGGTGGCTTTGCACACCGTCTTTTAC
GTGGCCGTCATTCAGTGCATGGCACTGGGTTATATCCACCGCCAAGTTTTTACTGCGATATTCGTCTTATGGGCT
CTCTGGCCATGTACATATGGCATGTCGTTTGTGCAACAACACGCCCTGCTGAGCGCAGCATGGGCTGTTGCGTGC
TTAGCAATGAGCATATTTACCCTGCTTCCGGCAATCAAGGTGGAAAATGTGCCACTCATCCTTGCCGGCGGAACA
ATCATGGCTGCAGCTGGCATCGTCTATCTCTTGTTTGATCAATTTGCGCCCTCGGGCTCATCACATTACATGTCT
AAGAGCAGTGGACCCAGGCTCGTATCCACCATGAATCACAGCATTAGGCGAACGCTTGTTGGTGCTCAGATTGGC
TTGATACTTCTGGCCATGGCTGTGACACGCTCAAGCGCCCTGAGCCTTCAGAAGAAGCAAGGCCTACCCCATGGG
AACCAGATTGTGGGATGGATAGTGCTCGTTGTGTCATTGCTCCTACCACTAGCATACCGCCTTGAAGCCAAAACG
CACTATACGCACCGGCTGGCCGTGGTTTCACTAATGTTTGCTCCCACCTTCATCATCTTAACCATCTCATACGAA
GCACTCTTCTATATTGCCTTCTGTAGCATCCTCTTCCTTTGGCTACGTCTTGAATACGCGGCTCAACGCTTCCTT
GATGGCCAGCAAGCTGCAGAGACCATAGCCAGTCGGCCAGACGAATACGTCCGTCCGGCACAATCACCACGTCCG
CTACAGCTCTCTGATGCTCGTGTGGCACTTTTCTTTATGGTGTTTCTACAATCTGCTTTTTTCAGTACCGGCAAC
GTGGCATCCGTTTCATCGTTTAGCCTCGACAGCGTGTACCGATTGATACCGATTTTCGACCCCATATCTCAGGGC
GCTCTCCTAGTCCTCAAGCTCATGATTCCCTTTGTGCTCATATCCGCCTACCTCGGAGTGCTCAACAAGAGACTT
GGGGTTGCTCCATCTGCTCTCTTCATGGTAGTCATGGCTGTGAGTGATATCCTAACGCTCTACTTCTTTTGGGTC
GTCAAGGACGAAGGCTCGTGGCTTGAAATCGGCTCCACCATTAGCCACTTTGCGATTGCAAGCATATTGTGCGTC
TTTGTGGCCGGGTTGGAGGGTGTCAGCGCTGTTCTCATTGCCGGAGTCAATCTTGAACATGACAATGGCGACAAT
GGCGGCAAAGGAGCGGTATCTGAATCACCATCAAGGACAGGTTGCGCGGAGCTCAAACACGCTAATGGACAGGTT
CTCGGGCACAGACAGGATGGACGAACCAGCCGTCATGATGCCAATAATGTAGGAAATCGTAGCATGTAA
Transcript >OphauB2|4960
ATGGCGGCGGCAGCTGGCGCAGTCACTCGCGCCGGCTTTCTAATAACAGCCGTCGTGTTCCATGCCGTCTATATA
ATGTCTATTTTCGACATTTATTTTGTCAGTCCAATTGTTTCTGGAATGAAACTGGTTGGCATTGAGCGCGCCAGC
ACAGTCAAGCCTCCTGCCGACCGACTTGTCCTCGTTGTTGGCGACGGTCTCCGGGCTGACAAGGCGTTTCAATGG
GCTGCAGAGCCATATGGCGAGTCGGAGGAGGATCTGGTGCCACGCCCGCTGGCGCCCTTTCTTCGATCACGCGTG
CTCGAGCACGGTACCTTTGGTGTATCTCACACACGCGTACCGACCGAATCGCGGCCCGGTCATGTCGCCCTTATT
GCAGGCCTCTACGAGGATGTGTCGGCCGTGGCGACTGGCTGGAAGCTTAATCCAGTTGACTTCGACAGTGTTTTC
AACCGCAGTCGCCATACGTGGAGCTGGGGCAGCCCCGACATTCTGCCCATGTTTGAACGAGGCGCCGTGCCTGGC
CGAGTCGATGCTCTGACTTATGAGCCTGATTTTGAAGACTTTTCGCAAGACGCCACTCGCCTAGACTACTGGGTC
TTTGACCACGTCAAGGATTTTTTTGCACAGGCTGCCTCGAACCAAAGCCTTGCCCAGGCCCTGCGCCAGGACCGC
TCCATCTTCTTTCTCCATTTGCTAGGGCTCGATACATCAGGACACGCCTACAGACCCTATTCCAACGAGTACCTA
TACAACATCAAGGTGGTCGATGAGGGTGTAGCGCAAGTAACAGACCTATTCAACAGCTTTTTTGGTGATGACAGG
ACAGCTTTTGTCTTTACCGCTGACCACGGCATGAGCGATTGGGGCAGCCACGGCGATGGTCATCCTGATAATACA
CGTACCCCTCTAATTGTATGGGGCTCGGGTGTTGCCCGTCCTGAAATCCACAACGACGTGATTGCTCCAGGCCAC
GATGAATTTTCTGCCGACTGGCACCTGCAACATGTTCGCCGCCACGATGTTGCACAAGCCGACGTAGCCGCTCTC
ATGGCATATCTAATTGGAACCGAATTCCCGGCCAATTCGGTCGGCAAACTGCCCCTCTCATATCTCTCTGCTGAT
AGCCGCGACAAAGCCTCAGCTTTTTTGGCCAATGCCCAGAGTATGCTCGAAATGTATCGTGTCAAGGAGGATATC
AAGAGGGCGAACCAAATCCGCTTCGTTCCTTACCCGCCCCTGAGCGAAAGTGTCGCCCCACCTGCTCAGCGATTG
GCCGCTATTCGTCACCTCATAGAGTCTGAAAAGCTTGACGAGGCCGTCGAGGAGACGGATGCCCTCATCACTATT
ACCCTAGAGGGGCTGCGCTATCTTCAGACATACGACTGGCTTTTCCTCCGTGCTCTCATTACAGCTGGGTACCTG
GGCTGGATGGTGTATGCCACAATTACCGTATTCGATCTATTTCTGCTACAACAGCCTGTGGCGCCACAGCGAACC
CTTGGCAGTGTCACCCTGTTTTCCTCATTATTTGCTGCAATGGTGGCCTCTTTCATCGTGTCTCACTCTCCACTG
ACTTACTACGCCTATGCCACCTTTCCAGTCTTGTTTTGGGAACAGGTGTATACTCGCCGCAACAGCCTGGTCCTG
GGATGCCGCGCCTTGTTTTGGCACGTCCAGTCTGCAGGGGCTTGGTTGACGGTGGCTTTGCACACCGTCTTTTAC
GTGGCCGTCATTCAGTGCATGGCACTGGGTTATATCCACCGCCAAGTTTTTACTGCGATATTCGTCTTATGGGCT
CTCTGGCCATGTACATATGGCATGTCGTTTGTGCAACAACACGCCCTGCTGAGCGCAGCATGGGCTGTTGCGTGC
TTAGCAATGAGCATATTTACCCTGCTTCCGGCAATCAAGGTGGAAAATGTGCCACTCATCCTTGCCGGCGGAACA
ATCATGGCTGCAGCTGGCATCGTCTATCTCTTGTTTGATCAATTTGCGCCCTCGGGCTCATCACATTACATGTCT
AAGAGCAGTGGACCCAGGCTCGTATCCACCATGAATCACAGCATTAGGCGAACGCTTGTTGGTGCTCAGATTGGC
TTGATACTTCTGGCCATGGCTGTGACACGCTCAAGCGCCCTGAGCCTTCAGAAGAAGCAAGGCCTACCCCATGGG
AACCAGATTGTGGGATGGATAGTGCTCGTTGTGTCATTGCTCCTACCACTAGCATACCGCCTTGAAGCCAAAACG
CACTATACGCACCGGCTGGCCGTGGTTTCACTAATGTTTGCTCCCACCTTCATCATCTTAACCATCTCATACGAA
GCACTCTTCTATATTGCCTTCTGTAGCATCCTCTTCCTTTGGCTACGTCTTGAATACGCGGCTCAACGCTTCCTT
GATGGCCAGCAAGCTGCAGAGACCATAGCCAGTCGGCCAGACGAATACGTCCGTCCGGCACAATCACCACGTCCG
CTACAGCTCTCTGATGCTCGTGTGGCACTTTTCTTTATGGTGTTTCTACAATCTGCTTTTTTCAGTACCGGCAAC
GTGGCATCCGTTTCATCGTTTAGCCTCGACAGCGTGTACCGATTGATACCGATTTTCGACCCCATATCTCAGGGC
GCTCTCCTAGTCCTCAAGCTCATGATTCCCTTTGTGCTCATATCCGCCTACCTCGGAGTGCTCAACAAGAGACTT
GGGGTTGCTCCATCTGCTCTCTTCATGGTAGTCATGGCTGTGAGTGATATCCTAACGCTCTACTTCTTTTGGGTC
GTCAAGGACGAAGGCTCGTGGCTTGAAATCGGCTCCACCATTAGCCACTTTGCGATTGCAAGCATATTGTGCGTC
TTTGTGGCCGGGTTGGAGGGTGTCAGCGCTGTTCTCATTGCCGGAGTCAATCTTGAACATGACAATGGCGACAAT
GGCGGCAAAGGAGCGGTATCTGAATCACCATCAAGGACAGGTTGCGCGGAGCTCAAACACGCTAATGGACAGGTT
CTCGGGCACAGACAGGATGGACGAACCAGCCGTCATGATGCCAATAATGTAGGAAATCGTAGCATGTAA
Gene >OphauB2|4960
ATGGCGGCGGCAGCTGGCGCAGTCACTCGCGCCGGCTTTCTAATAACAGCCGTCGTGTTCCATGCCGTCTATATA
ATGTCTATTTTCGACATTTATTTTGTCAGTCCAATTGTTTCTGGAATGAAACTGGTTGGCATTGAGCGCGCCAGC
ACAGTCAAGCCTCCTGCCGACCGACTTGTCCTCGTTGTTGGTAGGAAAATACCAAGCATCCACTTGAAGCAAATG
CCAAACTGACCATGCAGGCGACGGTCTCCGGGCTGACAAGGCGTTTCAATGGGCTGCAGAGCCATATGGCGAGTC
GGAGGAGGATCTGGTGCCACGCCCGCTGGCGCCCTTTCTTCGATCACGCGTGCTCGAGCACGGTACCTTTGGTGT
ATCTCACACACGCGTACCGACCGAATCGCGGCCCGGTCATGTCGCCCTTATTGCAGGCCTCTACGAGGATGTGTC
GGCCGTGGCGACTGGCTGGAAGCTTAATCCAGTTGACTTCGACAGTGTTTTCAACCGCAGTCGCCATACGTGGAG
CTGGGGCAGCCCCGACATTCTGCCCATGTTTGAACGAGGCGCCGTGCCTGGCCGAGTCGATGCTCTGACTTATGA
GCCTGATTTTGAAGACTTTTCGCAAGACGCCACTCGCCTAGACTACTGGGTCTTTGACCACGTCAAGGATTTTTT
TGCACAGGCTGCCTCGAACCAAAGCCTTGCCCAGGCCCTGCGCCAGGACCGCTCCATCTTCTTTCTCCATTTGCT
AGGGCTCGATACATCAGGACACGCCTACAGACCCTATTCCAACGAGTACCTATACAACATCAAGGTGGTCGATGA
GGGTGTAGCGCAAGTAACAGACCTATTCAACAGCTTTTTTGGTGATGACAGGACAGCTTTTGTCTTTACCGCTGA
CCACGGCATGAGCGATTGGGGCAGCCACGGCGATGGTCATCCTGATAATACACGTACCCCTCTAATTGTATGGGG
CTCGGGTGTTGCCCGTCCTGAAATCCACAACGACGTGATTGCTCCAGGCCACGATGAATTTTCTGCCGACTGGCA
CCTGCAACATGTTCGCCGCCACGATGTTGCACAAGCCGACGTAGCCGCTCTCATGGCATATCTAATTGGAACCGA
ATTCCCGGCCAATTCGGTCGGCAAACTGCCCCTCTCATATCTCTCTGCTGATAGCCGCGACAAAGCCTCAGCTTT
TTTGGCCAATGCCCAGAGTATGCTCGAAATGTATCGTGTCAAGGAGGATATCAAGAGGGCGAACCAAATCCGCTT
CGTTCCTTACCCGCCCCTGAGCGAAAGTGTCGCCCCACCTGCTCAGCGATTGGCCGCTATTCGTCACCTCATAGA
GTCTGAAAAGCTTGACGAGGCCGTCGAGGAGACGGATGCCCTCATCACTATTACCCTAGAGGGGCTGCGCTATCT
TCAGACATACGACTGGCTTTTCCTCCGTGCTCTCATTACAGCTGGGTACCTGGGCTGGATGGTGTATGCCACAAT
TACCGTATTCGATCTATTTCTGCTACAACAGCCTGTGGCGCCACAGCGAACCCTTGGCAGTGTCACCCTGTTTTC
CTCATTATTTGCTGCAATGGTGGCCTCTTTCATCGTGTCTCACTCTCCACTGACTTACTACGCCTATGCCACCTT
TCCAGTCTTGTTTTGGGAACAGGTGTATACTCGCCGCAACAGCCTGGTCCTGGGATGCCGCGCCTTGTTTTGGCA
CGTCCAGTCTGCAGGGGCTTGGTTGACGGTGGCTTTGCACACCGTCTTTTACGTGGCCGTCATTCAGTGCATGGT
TAGTACATTTGCCTGCTTGCAAGTGTCGTGTTGCTGACATGGGCTTGACCAGGCACTGGGTTATATCCACCGCCA
AGTTTTTACTGCGATATTCGTCTTATGGGCTCTCTGGCCATGTACATATGGCATGTCGTTTGTGCAACAACACGC
CCTGCTGAGCGCAGCATGGGCTGTTGCGTGCTTAGCAATGAGCATATTTACCCTGCTTCCGGCAATCAAGGTGGA
AAATGTGCCACTCATGTCAGTCGGCTTCTTTTGCCGTCATGGTGTTGAGCGTGAGCTGACCGTCTTGACAGCCTT
GCCGGCGGAACAATCATGGCTGCAGCTGGCATCGTCTATCTCTTGTTTGATCAATTTGCGCCCTCGGGCTCATCA
CATTACATGTCTAAGAGCAGTGGACCCAGGCTCGTATCCACCATGAATCACAGCATTAGGCGAACGCTTGTTGGT
GCTCAGGTACGTAGTACAACTGCTGTGATGGCTGGTAGACGGGCGGCCGGCTGACTTGGTGTGTGCGTGCGTGCT
GCAAAGATTGGCTTGATACTTCTGGCCATGGCTGTGACACGCTCAAGCGCCCTGAGCCTTCAGAAGAAGCAAGGC
CTACCCCATGGGAACCAGATTGTGGGATGGATAGTGCTCGGTTTGTCTTTCTGAAATCCTGTCTTGATGCAGTCG
AACTCATGTGCCCAACAGTTGTGTCATTGCTCCTACCACTAGCATACCGCCTTGAAGCCAAAACGCACTATACGC
ACCGGCTGGCCGTGGTTTCACTAATGTTTGCTCCCACCTTCATCATCTTAACCATCTCATACGAAGCACTCTTCT
ATATTGCCTTCTGTAGCATCCTCTTCCTTTGGCTACGTCTTGAATACGCGGCTCAACGCTTCCTTGATGGCCAGC
AAGCTGCAGAGACCATAGCCAGTCGGCCAGACGAATACGTCCGTCCGGCACAATCACCACGTCCGCTACAGCTCT
CTGATGCTCGTGTGGCACTTTTCTTTATGGTGTTTCTACAATCTGCTTTTTTCAGTACCGGCAACGTGGCATCCG
TTTCATCGTTTAGCCTCGACAGCGTGTACCGATTGATACCGATTTTCGACCCCATATCTCAGGGCGCTCTCCTAG
TCCTCAAGCTCATGATTCCCTTTGTGCTCATATCCGCCTACCTCGGAGTGCTCAACAAGAGACTTGGGGTTGCTC
CATCTGCTCTCTTCATGGTAGTCATGGCTGTGAGTGATATCCTAACGCTCTACTTCTTTTGGGTCGTCAAGGACG
AAGGCTCGTGGCTTGAAATCGGCTCCACCATTAGCCACTTTGCGATTGCAAGCATATTGTGCGTCTTTGTGGCCG
GGTTGGAGGGTGTCAGCGCTGTTCTCATTGCCGGAGTCAATCTTGAACATGACAATGGCGACAATGGCGGCAAAG
GAGCGGTATCTGAATCACCATCAAGGACAGGTTGCGCGGAGCTCAAACACGCTAATGGACAGGTTCTCGGGCACA
GACAGGATGGACGAACCAGCCGTCATGATGCCAATAATGTAGGAAATCGTAGCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail