Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4959
Gene name
LocationContig_354:174..1475
Strand+
Gene length (bp)1301
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1 2.2E-32 266 350

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13684|PCS1_SCHPO Monopolin complex subunit pcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcs1 PE=1 SV=4 250 364 5.0E-13

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4959
MSQQLEVDGPGEVGVGRNAGGPGRTLEDKDESNDTIDNVVHGRGRHAADLQTDLLQDDGPVASNIGRRKASKSVK
ERSEALLAQEEADSPDELSVLNVEVDATDSGVARPETGSASLRRRLGELTRRYDNLNTRHGELRDVGVKAAERNF
ERFKKQVEESAAVSDKLIAQLKEEVAAQASLASQGEQVQRQFELSRANSSQLQSQIDQLGTALAAARSEVETLSA
KLAASRSAAESHAAKLPGSALKPGSTANRIMQSTELLHAAQAKEDLYGDLTGLLVRGLKRDSGEDVFDCIQTGQN
GTLHFKLLLQRGDNYEDAQFTYRPQLDEDRDDALIKVLPDYLLEEITFLRSQASKFYSRVTKSLTERIH*
Coding >OphauB2|4959
ATGAGCCAGCAATTAGAGGTCGACGGACCGGGCGAGGTCGGGGTGGGCCGTAATGCCGGCGGCCCTGGACGGACA
CTTGAGGACAAGGACGAATCCAATGACACAATAGATAATGTTGTACACGGGCGCGGTAGACACGCGGCAGATTTG
CAGACAGACTTGTTGCAAGACGATGGACCTGTCGCGTCGAATATAGGGCGGCGAAAGGCTAGCAAAAGCGTCAAG
GAAAGAAGTGAAGCTCTGCTTGCTCAAGAGGAAGCCGACAGTCCAGATGAATTGTCGGTCCTCAACGTCGAGGTA
GATGCCACGGATAGCGGAGTCGCGCGCCCAGAGACTGGCAGTGCGTCGCTTCGCAGGCGACTTGGGGAGCTCACG
AGACGATATGATAACCTCAACACACGCCATGGCGAACTACGTGATGTGGGCGTCAAGGCAGCTGAACGCAACTTT
GAGCGCTTCAAGAAGCAAGTGGAAGAAAGTGCAGCAGTATCGGATAAGCTCATTGCACAACTGAAAGAAGAGGTG
GCAGCCCAGGCCAGTCTTGCCAGTCAAGGCGAGCAGGTGCAACGGCAGTTTGAGCTCAGTAGAGCCAACAGCAGC
CAACTCCAGAGCCAAATAGACCAGCTTGGCACTGCGCTCGCGGCAGCTCGCTCAGAAGTCGAGACGCTGTCTGCC
AAACTGGCAGCCAGTAGAAGTGCAGCCGAGAGCCATGCTGCCAAGTTGCCTGGCAGCGCTCTCAAGCCCGGCTCA
ACAGCAAATCGCATCATGCAGTCGACGGAGCTTCTTCACGCAGCCCAGGCAAAGGAAGACTTGTACGGGGATTTG
ACAGGACTGCTCGTGAGGGGCCTGAAGCGTGATTCAGGTGAGGACGTCTTTGACTGCATTCAGACTGGCCAAAAC
GGCACACTGCATTTCAAATTATTGCTCCAACGCGGCGACAACTATGAAGATGCCCAATTTACCTATCGACCGCAG
CTGGACGAGGATCGCGATGATGCTTTAATCAAGGTGCTCCCTGACTATCTGCTTGAGGAGATTACCTTTTTGCGA
TCACAGGCATCCAAATTTTATAGCAGAGTAACAAAGTCTCTGACGGAGCGCATTCACTAG
Transcript >OphauB2|4959
ATGAGCCAGCAATTAGAGGTCGACGGACCGGGCGAGGTCGGGGTGGGCCGTAATGCCGGCGGCCCTGGACGGACA
CTTGAGGACAAGGACGAATCCAATGACACAATAGATAATGTTGTACACGGGCGCGGTAGACACGCGGCAGATTTG
CAGACAGACTTGTTGCAAGACGATGGACCTGTCGCGTCGAATATAGGGCGGCGAAAGGCTAGCAAAAGCGTCAAG
GAAAGAAGTGAAGCTCTGCTTGCTCAAGAGGAAGCCGACAGTCCAGATGAATTGTCGGTCCTCAACGTCGAGGTA
GATGCCACGGATAGCGGAGTCGCGCGCCCAGAGACTGGCAGTGCGTCGCTTCGCAGGCGACTTGGGGAGCTCACG
AGACGATATGATAACCTCAACACACGCCATGGCGAACTACGTGATGTGGGCGTCAAGGCAGCTGAACGCAACTTT
GAGCGCTTCAAGAAGCAAGTGGAAGAAAGTGCAGCAGTATCGGATAAGCTCATTGCACAACTGAAAGAAGAGGTG
GCAGCCCAGGCCAGTCTTGCCAGTCAAGGCGAGCAGGTGCAACGGCAGTTTGAGCTCAGTAGAGCCAACAGCAGC
CAACTCCAGAGCCAAATAGACCAGCTTGGCACTGCGCTCGCGGCAGCTCGCTCAGAAGTCGAGACGCTGTCTGCC
AAACTGGCAGCCAGTAGAAGTGCAGCCGAGAGCCATGCTGCCAAGTTGCCTGGCAGCGCTCTCAAGCCCGGCTCA
ACAGCAAATCGCATCATGCAGTCGACGGAGCTTCTTCACGCAGCCCAGGCAAAGGAAGACTTGTACGGGGATTTG
ACAGGACTGCTCGTGAGGGGCCTGAAGCGTGATTCAGGTGAGGACGTCTTTGACTGCATTCAGACTGGCCAAAAC
GGCACACTGCATTTCAAATTATTGCTCCAACGCGGCGACAACTATGAAGATGCCCAATTTACCTATCGACCGCAG
CTGGACGAGGATCGCGATGATGCTTTAATCAAGGTGCTCCCTGACTATCTGCTTGAGGAGATTACCTTTTTGCGA
TCACAGGCATCCAAATTTTATAGCAGAGTAACAAAGTCTCTGACGGAGCGCATTCACTAG
Gene >OphauB2|4959
ATGAGCCAGCAATTAGAGGTCGACGGACCGGGCGAGGTCGGGGTTCGAGCAGTGTTAGCAGAGTTACCAAAGCCT
CTTCTACAAGATCGCGTCGAAAGGTGGGCCGTAATGCCGGCGGCCCTGGACGGACACTTGAGGACAAGGACGAAT
CCAATGACACAATAGATAATGTTGTACACGGGCGCGGTAGACACGCGGCAGATTTGCAGACAGACTTGTTGCAAG
ACGATGGACCTGTCGCGTCGAATATAGGGCGGCGAAAGGCTAGCAAAAGCGTCAAGGAAAGAAGTGAAGCTCTGC
TTGCTCAAGAGGAAGCCGACAGTCCAGATGAATTGTCGGTCCTCAACGTCGAGGTAGATGCCACGGATAGCGGAG
TCGCGCGCCCAGAGACTGGCAGTGCGTCGCTTCGCAGGCGACTTGGGGAGCTCACGAGACGATATGATAACCTCA
ACACACGCCATGGCGAACTACGTGATGTGGGCGTCAAGGCAGCTGAACGCAACTTTGAGCGCTTCAAGAAGCAAG
TGGAAGAAAGTGCAGCAGGTAGGGAAGACGGTAGTCCAAGCACAAGAGTGCTCGACGTTGACTGACGCGGGCTAT
TGATGCAGTATCGGATAAGCTCATTGCACAACTGAAAGAAGAGGTGGCAGCCCAGGCCAGTCTTGCCAGTCAAGG
CGAGCAGGTGCAACGGCAGTTTGAGCTCAGTAGAGCCAACAGCAGCCAACTCCAGAGCCAAATAGACCAGCTTGG
CACTGCGCTCGCGGCAGCTCGCTCAGAAGTCGAGACGCTGTCTGCCAAACTGGCAGCCAGTAGAAGTGCAGCCGA
GAGCCATGCTGCCAAGTTGCCTGGCAGCGCTCTCAAGCCCGGCTCAACAGCAAATCGCATCATGCAGTCGACGGA
GCTTCTTCACGCAGCCCAGGCAAAGGAAGACTTGTACGGGGATTTGACAGGACTGCTCGTGAGGGGCCTGAAGCG
TGATTCAGGTGAGGACGTCTTTGACTGCATTCAGACTGGCCAAAACGGCAGTAAGTTGCGCCCTTGATTTGCCTA
ATACACACTGCTCGCAAGCACAACTGATGGTCTGGATCTAAATAGCACTGCATTTCAAATTATTGCTCCAACGCG
GCGACAACTATGAAGATGCCCAATTTACCTATCGACCGCAGCTGGACGAGGATCGCGATGATGCTTTAATCAAGG
TGCTCCCTGACTATCTGCTTGAGGAGATTACCTTTTTGCGATCACAGGCATCCAAATTTTATAGCAGAGTAACAA
AGTCTCTGACGGAGCGCATTCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail