Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4958
Gene name
LocationContig_353:2387..3431
Strand-
Gene length (bp)1044
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16983 MFS_MOT1 Molybdate transporter of MFS superfamily 5.0E-07 3 47
PF16983 MFS_MOT1 Molybdate transporter of MFS superfamily 9.3E-36 136 255

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9SL95|MOT1_ARATH Molybdate transporter 1 OS=Arabidopsis thaliana GN=MOT1 PE=1 SV=1 4 342 2.0E-43
sp|Q0WP36|MOT2_ARATH Molybdate transporter 2 OS=Arabidopsis thaliana GN=MOT2 PE=1 SV=2 89 265 5.0E-40
sp|A6YCJ2|MOT1_CHLRE Molybdate transporter 1 OS=Chlamydomonas reinhardtii GN=MOT1 PE=1 SV=1 87 320 3.0E-33

GO

GO Term Description Terminal node
GO:0015098 molybdate ion transmembrane transporter activity Yes
GO:0015689 molybdate ion transport Yes
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0015698 inorganic anion transport No
GO:0006820 anion transport No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 56 17
3 90 109 19
4 180 202 22
5 215 237 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4958
MAVVVAAGQWVGLAVLIMSVTGLLRWAAYVVPVPVVKGIQLGAGLSLILGAGSSLLQPLKWLDPVLDNRLWALLA
FLVLITTQRMPRFPYALFFFCLAIVFALVRVFTSHHLHPSFHMWHPKFVLPSWFSSNDAPALSMAIGQLPLTTLN
SIIAVCALSSELLPQLPAPSVTSIGVSVGLMNLSGTWLGAMPVCHGAGGLAAQYRFGARSGSSIIVLGLFKLVLG
LLFGDTLVGVLAKFPKSILGVMVLAAGLELAKVGNTLNQEASDLWEVTQERSEFSRTLRKPGPEERLERWTVMLM
TTAGILAFRNDAIGFLAGLLCHGAYRLSSWIHKKQSSRVPEDRPLLD*
Coding >OphauB2|4958
ATGGCGGTTGTTGTGGCTGCTGGGCAGTGGGTGGGCTTGGCCGTCTTGATTATGAGCGTCACGGGCCTTCTTCGC
TGGGCTGCCTACGTGGTGCCTGTTCCCGTGGTCAAGGGCATCCAGCTAGGTGCTGGCCTCTCTCTCATTCTCGGC
GCTGGCTCGTCGCTGCTGCAGCCGCTCAAATGGCTCGACCCCGTCCTGGATAACCGCCTCTGGGCCCTGCTTGCC
TTTCTCGTCCTCATTACCACGCAGCGCATGCCTCGCTTCCCGTACGCCCTCTTCTTCTTTTGCCTCGCCATCGTC
TTTGCCCTGGTCCGCGTCTTTACCTCGCACCACCTTCACCCCTCCTTCCACATGTGGCACCCCAAGTTTGTCTTG
CCGTCTTGGTTCAGCTCCAATGACGCTCCCGCTCTGTCCATGGCCATTGGCCAGCTGCCCTTGACAACGCTCAAC
TCAATCATTGCCGTCTGTGCTCTGTCGTCGGAGCTCTTGCCCCAGCTGCCGGCTCCGTCGGTCACGTCTATTGGC
GTTAGCGTTGGCCTCATGAACCTCTCGGGGACTTGGCTCGGCGCAATGCCCGTGTGCCATGGCGCTGGAGGCCTG
GCAGCGCAGTATCGCTTTGGTGCCCGCAGTGGCTCGAGCATCATTGTCCTTGGCCTCTTCAAGTTGGTCCTGGGC
CTGCTGTTTGGCGATACCCTTGTCGGCGTGCTGGCCAAGTTCCCCAAGAGCATTCTGGGCGTCATGGTGCTGGCT
GCTGGCCTTGAACTGGCCAAGGTTGGCAACACCCTTAATCAGGAGGCCTCAGACTTGTGGGAGGTGACGCAGGAA
CGTAGCGAGTTCTCGCGCACTCTACGCAAGCCTGGCCCAGAGGAGCGCCTCGAGCGATGGACCGTGATGCTAATG
ACGACTGCCGGCATTCTGGCATTTCGAAATGACGCTATTGGCTTCCTGGCCGGCCTCTTGTGCCATGGCGCCTAT
AGACTTTCCTCTTGGATTCACAAGAAACAGTCTAGCCGTGTTCCAGAAGATCGACCGCTACTCGACTAG
Transcript >OphauB2|4958
ATGGCGGTTGTTGTGGCTGCTGGGCAGTGGGTGGGCTTGGCCGTCTTGATTATGAGCGTCACGGGCCTTCTTCGC
TGGGCTGCCTACGTGGTGCCTGTTCCCGTGGTCAAGGGCATCCAGCTAGGTGCTGGCCTCTCTCTCATTCTCGGC
GCTGGCTCGTCGCTGCTGCAGCCGCTCAAATGGCTCGACCCCGTCCTGGATAACCGCCTCTGGGCCCTGCTTGCC
TTTCTCGTCCTCATTACCACGCAGCGCATGCCTCGCTTCCCGTACGCCCTCTTCTTCTTTTGCCTCGCCATCGTC
TTTGCCCTGGTCCGCGTCTTTACCTCGCACCACCTTCACCCCTCCTTCCACATGTGGCACCCCAAGTTTGTCTTG
CCGTCTTGGTTCAGCTCCAATGACGCTCCCGCTCTGTCCATGGCCATTGGCCAGCTGCCCTTGACAACGCTCAAC
TCAATCATTGCCGTCTGTGCTCTGTCGTCGGAGCTCTTGCCCCAGCTGCCGGCTCCGTCGGTCACGTCTATTGGC
GTTAGCGTTGGCCTCATGAACCTCTCGGGGACTTGGCTCGGCGCAATGCCCGTGTGCCATGGCGCTGGAGGCCTG
GCAGCGCAGTATCGCTTTGGTGCCCGCAGTGGCTCGAGCATCATTGTCCTTGGCCTCTTCAAGTTGGTCCTGGGC
CTGCTGTTTGGCGATACCCTTGTCGGCGTGCTGGCCAAGTTCCCCAAGAGCATTCTGGGCGTCATGGTGCTGGCT
GCTGGCCTTGAACTGGCCAAGGTTGGCAACACCCTTAATCAGGAGGCCTCAGACTTGTGGGAGGTGACGCAGGAA
CGTAGCGAGTTCTCGCGCACTCTACGCAAGCCTGGCCCAGAGGAGCGCCTCGAGCGATGGACCGTGATGCTAATG
ACGACTGCCGGCATTCTGGCATTTCGAAATGACGCTATTGGCTTCCTGGCCGGCCTCTTGTGCCATGGCGCCTAT
AGACTTTCCTCTTGGATTCACAAGAAACAGTCTAGCCGTGTTCCAGAAGATCGACCGCTACTCGACTAG
Gene >OphauB2|4958
ATGGCGGTTGTTGTGGCTGCTGGGCAGTGGGTGGGCTTGGCCGTCTTGATTATGAGCGTCACGGGCCTTCTTCGC
TGGGCTGCCTACGTGGTGCCTGTTCCCGTGGTCAAGGGCATCCAGCTAGGTGCTGGCCTCTCTCTCATTCTCGGC
GCTGGCTCGTCGCTGCTGCAGCCGCTCAAATGGCTCGACCCCGTCCTGGATAACCGCCTCTGGGCCCTGCTTGCC
TTTCTCGTCCTCATTACCACGCAGCGCATGCCTCGCTTCCCGTACGCCCTCTTCTTCTTTTGCCTCGCCATCGTC
TTTGCCCTGGTCCGCGTCTTTACCTCGCACCACCTTCACCCCTCCTTCCACATGTGGCACCCCAAGTTTGTCTTG
CCGTCTTGGTTCAGCTCCAATGACGCTCCCGCTCTGTCCATGGCCATTGGCCAGCTGCCCTTGACAACGCTCAAC
TCAATCATTGCCGTCTGTGCTCTGTCGTCGGAGCTCTTGCCCCAGCTGCCGGCTCCGTCGGTCACGTCTATTGGC
GTTAGCGTTGGCCTCATGAACCTCTCGGGGACTTGGCTCGGCGCAATGCCCGTGTGCCATGGCGCTGGAGGCCTG
GCAGCGCAGTATCGCTTTGGTGCCCGCAGTGGCTCGAGCATCATTGTCCTTGGCCTCTTCAAGTTGGTCCTGGGC
CTGCTGTTTGGCGATACCCTTGTCGGCGTGCTGGCCAAGTTCCCCAAGAGCATTCTGGGCGTCATGGTGCTGGCT
GCTGGCCTTGAACTGGCCAAGGTTGGCAACACCCTTAATCAGGAGGCCTCAGACTTGTGGGAGGTGACGCAGGAA
CGTAGCGAGTTCTCGCGCACTCTACGCAAGCCTGGCCCAGAGGAGCGCCTCGAGCGATGGACCGTGATGCTAATG
ACGACTGCCGGCATTCTGGCATTTCGAAATGACGCTATTGGCTTCCTGGCCGGCCTCTTGTGCCATGGCGCCTAT
AGACTTTCCTCTTGGATTCACAAGAAACAGTCTAGCCGTGTTCCAGAAGATCGACCGCTACTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail