Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4955
Gene name
LocationContig_351:2138..4994
Strand-
Gene length (bp)2856
Transcript length (bp)2736
Coding sequence length (bp)2736
Protein length (aa) 912

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08676 MutL_C MutL C terminal dimerisation domain 3.6E-22 716 850
PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain 4.9E-18 239 352
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.3E-12 26 116
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.4E-07 23 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 4 438 1.0E-93
sp|P54280|PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pms1 PE=3 SV=1 1 368 4.0E-92
sp|P14242|PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMS1 PE=1 SV=3 1 372 4.0E-86
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 4 377 1.0E-82
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 4 355 1.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 4 438 1.0E-93
sp|P54280|PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pms1 PE=3 SV=1 1 368 4.0E-92
sp|P14242|PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMS1 PE=1 SV=3 1 372 4.0E-86
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 4 377 1.0E-82
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 4 355 1.0E-80
sp|Q54QA0|PMS1_DICDI Mismatch repair endonuclease pms1 OS=Dictyostelium discoideum GN=pms1 PE=3 SV=1 4 365 8.0E-73
sp|P14242|PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMS1 PE=1 SV=3 659 896 2.0E-59
sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 663 884 3.0E-53
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 663 884 3.0E-53
sp|P54280|PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pms1 PE=3 SV=1 654 885 7.0E-53
sp|A4D2B8|PM2P1_HUMAN Putative postmeiotic segregation increased 2-like protein 1 OS=Homo sapiens GN=PMS2P1 PE=5 SV=1 4 170 1.0E-47
sp|O95744|PM2P2_HUMAN Putative postmeiotic segregation increased 2-like protein 2 OS=Homo sapiens GN=PMS2P2 PE=5 SV=1 4 170 8.0E-47
sp|P54277|PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens GN=PMS1 PE=1 SV=1 4 353 9.0E-45
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 665 881 2.0E-44
sp|Q54QA0|PMS1_DICDI Mismatch repair endonuclease pms1 OS=Dictyostelium discoideum GN=pms1 PE=3 SV=1 667 884 2.0E-41
sp|P38920|MLH1_YEAST DNA mismatch repair protein MLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH1 PE=1 SV=2 4 411 5.0E-41
sp|A3CWX7|MUTL_METMJ DNA mismatch repair protein MutL OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=mutL PE=3 SV=1 1 357 1.0E-40
sp|P40692|MLH1_HUMAN DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1 2 341 3.0E-38
sp|Q8CPE9|MUTL_STAES DNA mismatch repair protein MutL OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutL PE=3 SV=1 1 418 4.0E-38
sp|Q5HPP4|MUTL_STAEQ DNA mismatch repair protein MutL OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutL PE=3 SV=1 1 418 4.0E-38
sp|Q9JK91|MLH1_MOUSE DNA mismatch repair protein Mlh1 OS=Mus musculus GN=Mlh1 PE=1 SV=2 2 341 4.0E-38
sp|Q8F6X4|MUTL_LEPIN DNA mismatch repair protein MutL OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mutL PE=3 SV=2 1 338 1.0E-37
sp|Q72PF7|MUTL_LEPIC DNA mismatch repair protein MutL OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mutL PE=3 SV=2 1 338 1.0E-37
sp|P65492|MUTL_STAAN DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain N315) GN=mutL PE=1 SV=1 1 397 1.0E-37
sp|P65491|MUTL_STAAM DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutL PE=3 SV=1 1 397 1.0E-37
sp|A6U1B5|MUTL_STAA2 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain JH1) GN=mutL PE=3 SV=1 1 397 1.0E-37
sp|A7X1T8|MUTL_STAA1 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutL PE=3 SV=1 1 397 1.0E-37
sp|Q65JE1|MUTL_BACLD DNA mismatch repair protein MutL OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutL PE=3 SV=1 1 411 2.0E-37
sp|B2RL29|MUTL_PORG3 DNA mismatch repair protein MutL OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=mutL PE=3 SV=1 3 359 2.0E-37
sp|Q04QW2|MUTL_LEPBJ DNA mismatch repair protein MutL OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mutL PE=3 SV=1 1 338 2.0E-37
sp|Q04Z69|MUTL_LEPBL DNA mismatch repair protein MutL OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mutL PE=3 SV=1 1 338 2.0E-37
sp|Q8NWX9|MUTL_STAAW DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MW2) GN=mutL PE=3 SV=1 1 396 3.0E-37
sp|Q6G9R7|MUTL_STAAS DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MSSA476) GN=mutL PE=3 SV=1 1 396 3.0E-37
sp|Q0AYB2|MUTL_SYNWW DNA mismatch repair protein MutL OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mutL PE=3 SV=1 3 357 3.0E-37
sp|Q03EQ8|MUTL_PEDPA DNA mismatch repair protein MutL OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mutL PE=3 SV=1 1 369 3.0E-37
sp|Q7MX15|MUTL_PORGI DNA mismatch repair protein MutL OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=mutL PE=3 SV=1 3 359 3.0E-37
sp|Q6GHD9|MUTL_STAAR DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MRSA252) GN=mutL PE=3 SV=1 1 396 4.0E-37
sp|A8Z1W7|MUTL_STAAT DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutL PE=3 SV=1 1 396 4.0E-37
sp|A6QGJ5|MUTL_STAAE DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Newman) GN=mutL PE=3 SV=1 1 396 4.0E-37
sp|Q5HGD5|MUTL_STAAC DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain COL) GN=mutL PE=3 SV=1 1 396 4.0E-37
sp|Q93T05|MUTL_STAA8 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain NCTC 8325) GN=mutL PE=3 SV=2 1 396 4.0E-37
sp|Q2FHE2|MUTL_STAA3 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain USA300) GN=mutL PE=3 SV=1 1 396 4.0E-37
sp|A6LEJ8|MUTL_PARD8 DNA mismatch repair protein MutL OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mutL PE=3 SV=1 4 359 4.0E-37
sp|C4L192|MUTL_EXISA DNA mismatch repair protein MutL OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=mutL PE=3 SV=1 1 389 6.0E-37
sp|B9EBI5|MUTL_MACCJ DNA mismatch repair protein MutL OS=Macrococcus caseolyticus (strain JCSC5402) GN=mutL PE=3 SV=1 1 378 1.0E-36
sp|Q49X89|MUTL_STAS1 DNA mismatch repair protein MutL OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutL PE=3 SV=1 1 418 1.0E-36
sp|C0MAS4|MUTL_STRE4 DNA mismatch repair protein MutL OS=Streptococcus equi subsp. equi (strain 4047) GN=mutL PE=3 SV=1 1 401 1.0E-36
sp|B0TB10|MUTL_HELMI DNA mismatch repair protein MutL OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mutL PE=3 SV=1 1 333 3.0E-36
sp|Q5M6H7|MUTL_STRT2 DNA mismatch repair protein MutL OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mutL PE=3 SV=1 13 370 3.0E-36
sp|Q5M1Y6|MUTL_STRT1 DNA mismatch repair protein MutL OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mutL PE=3 SV=1 13 370 3.0E-36
sp|Q03MY0|MUTL_STRTD DNA mismatch repair protein MutL OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mutL PE=3 SV=1 13 370 3.0E-36
sp|C0MGC4|MUTL_STRS7 DNA mismatch repair protein MutL OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=mutL PE=3 SV=1 1 401 3.0E-36
sp|A8FDH4|MUTL_BACP2 DNA mismatch repair protein MutL OS=Bacillus pumilus (strain SAFR-032) GN=mutL PE=3 SV=1 1 427 4.0E-36
sp|P97679|MLH1_RAT DNA mismatch repair protein Mlh1 OS=Rattus norvegicus GN=Mlh1 PE=2 SV=1 2 341 4.0E-36
sp|C4ZA52|MUTL_EUBR3 DNA mismatch repair protein MutL OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=mutL PE=3 SV=1 1 436 7.0E-36
sp|Q1WT16|MUTL_LACS1 DNA mismatch repair protein MutL OS=Lactobacillus salivarius (strain UCC118) GN=mutL PE=3 SV=1 1 370 8.0E-36
sp|B4U0J7|MUTL_STREM DNA mismatch repair protein MutL OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=mutL PE=3 SV=1 1 401 9.0E-36
sp|A7Z4X6|MUTL_BACMF DNA mismatch repair protein MutL OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mutL PE=3 SV=1 1 395 1.0E-35
sp|B9DW70|MUTL_STRU0 DNA mismatch repair protein MutL OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=mutL PE=3 SV=1 1 370 1.0E-35
sp|B7ITM0|MUTL_BACC2 DNA mismatch repair protein MutL OS=Bacillus cereus (strain G9842) GN=mutL PE=3 SV=1 1 425 2.0E-35
sp|Q87L05|MUTL_VIBPA DNA mismatch repair protein MutL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutL PE=3 SV=1 3 384 2.0E-35
sp|P49850|MUTL_BACSU DNA mismatch repair protein MutL OS=Bacillus subtilis (strain 168) GN=mutL PE=1 SV=1 1 401 3.0E-35
sp|A8YTI0|MUTL_LACH4 DNA mismatch repair protein MutL OS=Lactobacillus helveticus (strain DPC 4571) GN=mutL PE=3 SV=1 1 358 4.0E-35
sp|A9VS12|MUTL_BACWK DNA mismatch repair protein MutL OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutL PE=3 SV=1 1 385 4.0E-35
sp|B9DPC0|MUTL_STACT DNA mismatch repair protein MutL OS=Staphylococcus carnosus (strain TM300) GN=mutL PE=3 SV=1 1 360 5.0E-35
sp|A7GR98|MUTL_BACCN DNA mismatch repair protein MutL OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutL PE=3 SV=1 1 382 6.0E-35
sp|P0DC59|MUTL_STRPQ DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mutL PE=3 SV=1 13 393 7.0E-35
sp|P0DC58|MUTL_STRP3 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mutL PE=3 SV=1 13 393 7.0E-35
sp|A6KXH3|MUTL_BACV8 DNA mismatch repair protein MutL OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutL PE=3 SV=1 4 351 7.0E-35
sp|B5XJ09|MUTL_STRPZ DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=mutL PE=3 SV=1 13 393 7.0E-35
sp|Q5X9H5|MUTL_STRP6 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mutL PE=3 SV=2 13 393 7.0E-35
sp|A2RGV3|MUTL_STRPG DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mutL PE=3 SV=1 13 393 8.0E-35
sp|Q99XN7|MUTL_STRP1 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M1 GN=mutL PE=3 SV=1 13 393 9.0E-35
sp|B3W9W3|MUTL_LACCB DNA mismatch repair protein MutL OS=Lactobacillus casei (strain BL23) GN=mutL PE=3 SV=1 1 373 9.0E-35
sp|Q3JYM6|MUTL_STRA1 DNA mismatch repair protein MutL OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mutL PE=3 SV=1 13 370 1.0E-34
sp|Q8NZ25|MUTL_STRP8 DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mutL PE=3 SV=1 13 393 1.0E-34
sp|B9IV58|MUTL_BACCQ DNA mismatch repair protein MutL OS=Bacillus cereus (strain Q1) GN=mutL PE=3 SV=1 1 425 1.0E-34
sp|Q1JJH1|MUTL_STRPC DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mutL PE=3 SV=1 13 393 1.0E-34
sp|Q1J9C2|MUTL_STRPB DNA mismatch repair protein MutL OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=mutL PE=3 SV=1 13 393 1.0E-34
sp|Q8E2R5|MUTL_STRA3 DNA mismatch repair protein MutL OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mutL PE=3 SV=1 13 370 2.0E-34
sp|Q035Z3|MUTL_LACC3 DNA mismatch repair protein MutL OS=Lactobacillus casei (strain ATCC 334) GN=mutL PE=3 SV=1 1 373 2.0E-34
sp|Q732V8|MUTL_BACC1 DNA mismatch repair protein MutL OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutL PE=3 SV=1 1 425 2.0E-34
sp|C1ENZ2|MUTL_BACC3 DNA mismatch repair protein MutL OS=Bacillus cereus (strain 03BB102) GN=mutL PE=3 SV=1 1 361 3.0E-34
sp|A0RHE0|MUTL_BACAH DNA mismatch repair protein MutL OS=Bacillus thuringiensis (strain Al Hakam) GN=mutL PE=3 SV=1 1 361 3.0E-34
sp|Q6HF47|MUTL_BACHK DNA mismatch repair protein MutL OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutL PE=3 SV=1 1 361 3.0E-34
sp|Q81WR4|MUTL_BACAN DNA mismatch repair protein MutL OS=Bacillus anthracis GN=mutL PE=3 SV=1 1 425 3.0E-34
sp|C3L823|MUTL_BACAC DNA mismatch repair protein MutL OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutL PE=3 SV=1 1 425 3.0E-34
sp|C3P5H4|MUTL_BACAA DNA mismatch repair protein MutL OS=Bacillus anthracis (strain A0248) GN=mutL PE=3 SV=1 1 425 3.0E-34
sp|Q81A26|MUTL_BACCR DNA mismatch repair protein MutL OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutL PE=3 SV=1 1 361 3.0E-34
sp|B7HDP3|MUTL_BACC4 DNA mismatch repair protein MutL OS=Bacillus cereus (strain B4264) GN=mutL PE=3 SV=1 1 361 3.0E-34
sp|B7HLA2|MUTL_BACC7 DNA mismatch repair protein MutL OS=Bacillus cereus (strain AH187) GN=mutL PE=3 SV=1 1 361 3.0E-34
sp|Q636Q8|MUTL_BACCZ DNA mismatch repair protein MutL OS=Bacillus cereus (strain ZK / E33L) GN=mutL PE=3 SV=1 1 361 3.0E-34
sp|B7JJ46|MUTL_BACC0 DNA mismatch repair protein MutL OS=Bacillus cereus (strain AH820) GN=mutL PE=3 SV=1 1 361 4.0E-34
sp|B1YMD8|MUTL_EXIS2 DNA mismatch repair protein MutL OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mutL PE=3 SV=1 1 350 6.0E-34
sp|Q8A120|MUTL_BACTN DNA mismatch repair protein MutL OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mutL PE=3 SV=1 13 357 6.0E-34
sp|Q64NX1|MUTL_BACFR DNA mismatch repair protein MutL OS=Bacteroides fragilis (strain YCH46) GN=mutL PE=3 SV=1 13 351 1.0E-33
sp|Q5L8M5|MUTL_BACFN DNA mismatch repair protein MutL OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mutL PE=3 SV=1 13 351 1.0E-33
sp|Q8Y788|MUTL_LISMO DNA mismatch repair protein MutL OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutL PE=3 SV=1 13 480 1.0E-33
sp|Q3AUA2|MUTL_CHLCH DNA mismatch repair protein MutL OS=Chlorobium chlorochromatii (strain CaD3) GN=mutL PE=3 SV=1 1 338 2.0E-33
sp|Q02VS5|MUTL_LACLS DNA mismatch repair protein MutL OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mutL PE=3 SV=1 1 361 2.0E-33
sp|C1L2W0|MUTL_LISMC DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutL PE=3 SV=1 13 480 2.0E-33
sp|B2GB18|MUTL_LACF3 DNA mismatch repair protein MutL OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutL PE=3 SV=1 1 390 3.0E-33
sp|Q048Y5|MUTL_LACDB DNA mismatch repair protein MutL OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mutL PE=3 SV=1 1 377 3.0E-33
sp|A4J5Q3|MUTL_DESRM DNA mismatch repair protein MutL OS=Desulfotomaculum reducens (strain MI-1) GN=mutL PE=3 SV=1 1 351 3.0E-33
sp|Q1G939|MUTL_LACDA DNA mismatch repair protein MutL OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mutL PE=3 SV=1 1 377 3.0E-33
sp|Q9KAC1|MUTL_BACHD DNA mismatch repair protein MutL OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutL PE=3 SV=1 1 366 4.0E-33
sp|A2SSN1|MUTL_METLZ DNA mismatch repair protein MutL OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=mutL PE=3 SV=1 1 333 4.0E-33
sp|A2RP08|MUTL_LACLM DNA mismatch repair protein MutL OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mutL PE=3 SV=1 1 361 5.0E-33
sp|A0B977|MUTL_METTP DNA mismatch repair protein MutL OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutL PE=3 SV=1 1 352 6.0E-33
sp|B4S3X8|MUTL_PROA2 DNA mismatch repair protein MutL OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=mutL PE=3 SV=1 1 405 6.0E-33
sp|Q8RA70|MUTL_CALS4 DNA mismatch repair protein MutL OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutL PE=3 SV=1 1 351 8.0E-33
sp|Q71ZR6|MUTL_LISMF DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutL PE=3 SV=1 13 480 9.0E-33
sp|Q8DRX0|MUTL_STRMU DNA mismatch repair protein MutL OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mutL PE=3 SV=1 13 370 1.0E-32
sp|Q045Q4|MUTL_LACGA DNA mismatch repair protein MutL OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutL PE=3 SV=1 1 359 1.0E-32
sp|Q9CDL1|MUTL_LACLA DNA mismatch repair protein MutL OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mutL PE=3 SV=2 1 361 1.0E-32
sp|B1I293|MUTL_DESAP DNA mismatch repair protein MutL OS=Desulforudis audaxviator (strain MP104C) GN=mutL PE=3 SV=1 1 333 1.0E-32
sp|B8CX97|MUTL_HALOH DNA mismatch repair protein MutL OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutL PE=3 SV=1 1 333 2.0E-32
sp|B8DFS3|MUTL_LISMH DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutL PE=3 SV=1 13 480 2.0E-32
sp|B1ZZY2|MUTL_OPITP DNA mismatch repair protein MutL OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=mutL PE=3 SV=1 1 358 3.0E-32
sp|Q9HSM6|MUTL_HALSA DNA mismatch repair protein MutL OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mutL PE=3 SV=1 4 353 3.0E-32
sp|B0R2S6|MUTL_HALS3 DNA mismatch repair protein MutL OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mutL PE=3 SV=1 4 353 3.0E-32
sp|A3CR14|MUTL_STRSV DNA mismatch repair protein MutL OS=Streptococcus sanguinis (strain SK36) GN=mutL PE=3 SV=1 1 370 3.0E-32
sp|Q5WFY4|MUTL_BACSK DNA mismatch repair protein MutL OS=Bacillus clausii (strain KSM-K16) GN=mutL PE=3 SV=1 1 351 3.0E-32
sp|B4SGC3|MUTL_PELPB DNA mismatch repair protein MutL OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=mutL PE=3 SV=1 1 338 3.0E-32
sp|A0AIK6|MUTL_LISW6 DNA mismatch repair protein MutL OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutL PE=3 SV=1 13 480 4.0E-32
sp|Q92BV2|MUTL_LISIN DNA mismatch repair protein MutL OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutL PE=3 SV=1 13 371 4.0E-32
sp|Q5FLX4|MUTL_LACAC DNA mismatch repair protein MutL OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mutL PE=3 SV=1 1 353 5.0E-32
sp|A6TR78|MUTL_ALKMQ DNA mismatch repair protein MutL OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutL PE=3 SV=1 1 368 6.0E-32
sp|Q9ZRV4|MLH1_ARATH DNA mismatch repair protein MLH1 OS=Arabidopsis thaliana GN=MLH1 PE=2 SV=1 4 349 7.0E-32
sp|A4SGM5|MUTL_CHLPM DNA mismatch repair protein MutL OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mutL PE=3 SV=1 1 338 7.0E-32
sp|Q01QW7|MUTL_SOLUE DNA mismatch repair protein MutL OS=Solibacter usitatus (strain Ellin6076) GN=mutL PE=3 SV=1 1 421 9.0E-32
sp|A5EXM6|MUTL_DICNV DNA mismatch repair protein MutL OS=Dichelobacter nodosus (strain VCS1703A) GN=mutL PE=3 SV=1 1 379 1.0E-31
sp|P73349|MUTL_SYNY3 DNA mismatch repair protein MutL OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutL PE=3 SV=2 4 351 1.0E-31
sp|A1SA23|MUTL_SHEAM DNA mismatch repair protein MutL OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutL PE=3 SV=1 4 406 1.0E-31
sp|B2TIB8|MUTL_CLOBB DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutL PE=3 SV=1 1 372 1.0E-31
sp|B4RLX4|MUTL_NEIG2 DNA mismatch repair protein MutL OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mutL PE=3 SV=1 1 351 2.0E-31
sp|Q74KW0|MUTL_LACJO DNA mismatch repair protein MutL OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutL PE=3 SV=1 1 359 2.0E-31
sp|A8FRD3|MUTL_SHESH DNA mismatch repair protein MutL OS=Shewanella sediminis (strain HAW-EB3) GN=mutL PE=3 SV=1 3 349 2.0E-31
sp|Q5F8M6|MUTL_NEIG1 DNA mismatch repair protein MutL OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mutL PE=1 SV=1 1 351 2.0E-31
sp|B1N024|MUTL_LEUCK DNA mismatch repair protein MutL OS=Leuconostoc citreum (strain KM20) GN=mutL PE=3 SV=1 1 370 2.0E-31
sp|Q9JTS2|MUTL_NEIMA DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mutL PE=3 SV=1 1 351 2.0E-31
sp|A9M0G1|MUTL_NEIM0 DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup C (strain 053442) GN=mutL PE=3 SV=1 1 351 3.0E-31
sp|Q9RTR0|MUTL_DEIRA DNA mismatch repair protein MutL OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mutL PE=3 SV=1 4 380 3.0E-31
sp|A5D2K5|MUTL_PELTS DNA mismatch repair protein MutL OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutL PE=3 SV=1 1 338 3.0E-31
sp|B8CIX3|MUTL_SHEPW DNA mismatch repair protein MutL OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mutL PE=3 SV=1 4 349 4.0E-31
sp|C1A8L2|MUTL_GEMAT DNA mismatch repair protein MutL OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=mutL PE=3 SV=1 1 366 4.0E-31
sp|A0Q0M7|MUTL_CLONN DNA mismatch repair protein MutL OS=Clostridium novyi (strain NT) GN=mutL PE=3 SV=1 1 350 4.0E-31
sp|Q3B1F8|MUTL_CHLL7 DNA mismatch repair protein MutL OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=mutL PE=3 SV=1 1 338 4.0E-31
sp|A1KUP6|MUTL_NEIMF DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mutL PE=3 SV=1 1 351 5.0E-31
sp|A8AZU1|MUTL_STRGC DNA mismatch repair protein MutL OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mutL PE=3 SV=1 1 370 5.0E-31
sp|A0LZH8|MUTL_GRAFK DNA mismatch repair protein MutL OS=Gramella forsetii (strain KT0803) GN=mutL PE=3 SV=1 4 349 6.0E-31
sp|B0TU66|MUTL_SHEHH DNA mismatch repair protein MutL OS=Shewanella halifaxensis (strain HAW-EB4) GN=mutL PE=3 SV=1 3 349 6.0E-31
sp|Q12J93|MUTL_SHEDO DNA mismatch repair protein MutL OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mutL PE=3 SV=1 13 349 6.0E-31
sp|Q7MH01|MUTL_VIBVY DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain YJ016) GN=mutL PE=3 SV=1 3 359 7.0E-31
sp|B0ST13|MUTL_LEPBP DNA mismatch repair protein MutL OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=mutL PE=3 SV=1 1 355 8.0E-31
sp|B0SB85|MUTL_LEPBA DNA mismatch repair protein MutL OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=mutL PE=3 SV=1 1 355 8.0E-31
sp|A4IMI1|MUTL_GEOTN DNA mismatch repair protein MutL OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mutL PE=3 SV=1 1 362 8.0E-31
sp|Q8DCV0|MUTL_VIBVU DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain CMCP6) GN=mutL PE=3 SV=1 3 359 9.0E-31
sp|A8H8G8|MUTL_SHEPA DNA mismatch repair protein MutL OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mutL PE=3 SV=1 4 373 9.0E-31
sp|Q7WG61|MUTL_BORBR DNA mismatch repair protein MutL OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutL PE=3 SV=1 12 339 1.0E-30
sp|B1KHV0|MUTL_SHEWM DNA mismatch repair protein MutL OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mutL PE=3 SV=1 3 349 1.0E-30
sp|Q7W0A6|MUTL_BORPE DNA mismatch repair protein MutL OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutL PE=3 SV=1 12 339 1.0E-30
sp|Q7W4N5|MUTL_BORPA DNA mismatch repair protein MutL OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutL PE=3 SV=1 12 339 1.0E-30
sp|Q5GZ85|MUTL_XANOR DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutL PE=3 SV=1 4 350 2.0E-30
sp|B2SHP8|MUTL_XANOP DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mutL PE=3 SV=1 4 350 2.0E-30
sp|Q2P295|MUTL_XANOM DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mutL PE=3 SV=1 4 350 2.0E-30
sp|A7HNR3|MUTL_FERNB DNA mismatch repair protein MutL OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mutL PE=3 SV=1 1 352 2.0E-30
sp|Q3ACA6|MUTL_CARHZ DNA mismatch repair protein MutL OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutL PE=3 SV=1 1 349 2.0E-30
sp|B0K1A3|MUTL_THEPX DNA mismatch repair protein MutL OS=Thermoanaerobacter sp. (strain X514) GN=mutL PE=3 SV=1 1 367 2.0E-30
sp|B2KB18|MUTL_ELUMP DNA mismatch repair protein MutL OS=Elusimicrobium minutum (strain Pei191) GN=mutL PE=3 SV=1 1 376 3.0E-30
sp|A6VD59|MUTL_PSEA7 DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain PA7) GN=mutL PE=3 SV=1 4 361 3.0E-30
sp|B7GIA3|MUTL_ANOFW DNA mismatch repair protein MutL OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=mutL PE=3 SV=1 1 366 3.0E-30
sp|C0R515|MUTL_WOLWR DNA mismatch repair protein MutL OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mutL PE=3 SV=1 1 380 3.0E-30
sp|Q3BSD0|MUTL_XANC5 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutL PE=3 SV=1 3 350 4.0E-30
sp|Q9HUL8|MUTL_PSEAE DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutL PE=3 SV=1 4 361 4.0E-30
sp|B7V209|MUTL_PSEA8 DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain LESB58) GN=mutL PE=3 SV=1 4 361 4.0E-30
sp|Q0I463|MUTL_HAES1 DNA mismatch repair protein MutL OS=Haemophilus somnus (strain 129Pt) GN=mutL PE=3 SV=1 3 420 4.0E-30
sp|Q9JYT2|MUTL_NEIMB DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutL PE=3 SV=1 1 351 4.0E-30
sp|Q02F72|MUTL_PSEAB DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutL PE=3 SV=1 4 361 5.0E-30
sp|B0K9L6|MUTL_THEP3 DNA mismatch repair protein MutL OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mutL PE=3 SV=1 1 367 5.0E-30
sp|B0U5C6|MUTL_XYLFM DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M12) GN=mutL PE=3 SV=1 4 337 5.0E-30
sp|C1CBX8|MUTL_STRZJ DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain JJA) GN=mutL PE=3 SV=1 1 370 6.0E-30
sp|C3LR77|MUTL_VIBCM DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain M66-2) GN=mutL PE=3 SV=1 3 375 6.0E-30
sp|Q9KV13|MUTL_VIBCH DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mutL PE=3 SV=1 3 375 6.0E-30
sp|A5F3L5|MUTL_VIBC3 DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mutL PE=3 SV=1 3 375 6.0E-30
sp|Q5L0E4|MUTL_GEOKA DNA mismatch repair protein MutL OS=Geobacillus kaustophilus (strain HTA426) GN=mutL PE=3 SV=1 1 353 7.0E-30
sp|Q0STR3|MUTL_CLOPS DNA mismatch repair protein MutL OS=Clostridium perfringens (strain SM101 / Type A) GN=mutL PE=3 SV=1 1 351 7.0E-30
sp|B5E6C5|MUTL_STRP4 DNA mismatch repair protein MutL OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=mutL PE=3 SV=1 1 370 8.0E-30
sp|Q8PJX2|MUTL_XANAC DNA mismatch repair protein MutL OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutL PE=3 SV=1 4 350 8.0E-30
sp|A3QAD8|MUTL_SHELP DNA mismatch repair protein MutL OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mutL PE=3 SV=1 3 439 8.0E-30
sp|B2IS10|MUTL_STRPS DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain CGSP14) GN=mutL PE=3 SV=1 1 370 8.0E-30
sp|B8ZKC9|MUTL_STRPJ DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mutL PE=3 SV=1 1 370 8.0E-30
sp|Q04MR4|MUTL_STRP2 DNA mismatch repair protein MutL OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mutL PE=3 SV=1 1 370 8.0E-30
sp|P0A3R2|HEXB_STRR6 DNA mismatch repair protein HexB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hexB PE=3 SV=1 1 370 8.0E-30
sp|P0A3R1|HEXB_STRPN DNA mismatch repair protein HexB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hexB PE=3 SV=1 1 370 8.0E-30
sp|B1I8F2|MUTL_STRPI DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mutL PE=3 SV=1 1 370 8.0E-30
sp|C1DLQ0|MUTL_AZOVD DNA mismatch repair protein MutL OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutL PE=3 SV=1 2 352 9.0E-30
sp|C1CP43|MUTL_STRZT DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mutL PE=3 SV=1 1 370 9.0E-30
sp|C1CI68|MUTL_STRZP DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain P1031) GN=mutL PE=3 SV=1 1 370 9.0E-30
sp|Q8XL86|MUTL_CLOPE DNA mismatch repair protein MutL OS=Clostridium perfringens (strain 13 / Type A) GN=mutL PE=3 SV=1 1 351 1.0E-29
sp|B2G6E6|MUTL_LACRJ DNA mismatch repair protein MutL OS=Lactobacillus reuteri (strain JCM 1112) GN=mutL PE=3 SV=1 1 422 1.0E-29
sp|A5VIX0|MUTL_LACRD DNA mismatch repair protein MutL OS=Lactobacillus reuteri (strain DSM 20016) GN=mutL PE=3 SV=1 1 422 1.0E-29
sp|A5FNH2|MUTL_FLAJ1 DNA mismatch repair protein MutL OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutL PE=3 SV=1 2 377 1.0E-29
sp|Q87AC9|MUTL_XYLFT DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutL PE=3 SV=1 4 337 1.0E-29
sp|B2I9E6|MUTL_XYLF2 DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M23) GN=mutL PE=3 SV=1 4 337 1.0E-29
sp|A9MDX3|MUTL_BRUC2 DNA mismatch repair protein MutL OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutL PE=3 SV=1 3 426 1.0E-29
sp|P65490|MUTL_BRUSU DNA mismatch repair protein MutL OS=Brucella suis biovar 1 (strain 1330) GN=mutL PE=3 SV=1 3 426 1.0E-29
sp|A5VTW1|MUTL_BRUO2 DNA mismatch repair protein MutL OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutL PE=3 SV=1 3 426 1.0E-29
sp|P65489|MUTL_BRUME DNA mismatch repair protein MutL OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutL PE=3 SV=1 3 426 1.0E-29
sp|Q579M7|MUTL_BRUAB DNA mismatch repair protein MutL OS=Brucella abortus biovar 1 (strain 9-941) GN=mutL PE=3 SV=1 3 426 1.0E-29
sp|Q2YIH2|MUTL_BRUA2 DNA mismatch repair protein MutL OS=Brucella abortus (strain 2308) GN=mutL PE=3 SV=1 3 426 1.0E-29
sp|B2SD15|MUTL_BRUA1 DNA mismatch repair protein MutL OS=Brucella abortus (strain S19) GN=mutL PE=3 SV=1 3 426 1.0E-29
sp|Q07XW5|MUTL_SHEFN DNA mismatch repair protein MutL OS=Shewanella frigidimarina (strain NCIMB 400) GN=mutL PE=3 SV=1 13 352 1.0E-29
sp|C0RKF6|MUTL_BRUMB DNA mismatch repair protein MutL OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=mutL PE=3 SV=1 3 372 2.0E-29
sp|Q2KX20|MUTL_BORA1 DNA mismatch repair protein MutL OS=Bordetella avium (strain 197N) GN=mutL PE=3 SV=1 12 339 2.0E-29
sp|A9WXS2|MUTL_BRUSI DNA mismatch repair protein MutL OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutL PE=3 SV=1 3 426 2.0E-29
sp|Q03R34|MUTL_LACBA DNA mismatch repair protein MutL OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutL PE=3 SV=1 1 361 2.0E-29
sp|Q8YSM9|MUTL_NOSS1 DNA mismatch repair protein MutL OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mutL PE=3 SV=1 2 401 2.0E-29
sp|C5D9H6|MUTL_GEOSW DNA mismatch repair protein MutL OS=Geobacillus sp. (strain WCH70) GN=mutL PE=3 SV=1 1 383 2.0E-29
sp|Q821I9|MUTL_CHLCV DNA mismatch repair protein MutL OS=Chlamydophila caviae (strain GPIC) GN=mutL PE=3 SV=1 4 367 2.0E-29
sp|Q4UJQ1|MUTL_RICFE DNA mismatch repair protein MutL OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutL PE=3 SV=1 3 402 3.0E-29
sp|Q8P8E4|MUTL_XANCP DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutL PE=3 SV=1 3 362 3.0E-29
sp|B0RRZ8|MUTL_XANCB DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain B100) GN=mutL PE=3 SV=1 3 362 3.0E-29
sp|Q4UVP3|MUTL_XANC8 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutL PE=3 SV=1 3 362 3.0E-29
sp|A4G289|MUTL_HERAR DNA mismatch repair protein MutL OS=Herminiimonas arsenicoxydans GN=mutL PE=3 SV=1 4 420 3.0E-29
sp|C1FNT8|MUTL_CLOBJ DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutL PE=3 SV=1 1 351 3.0E-29
sp|Q1RGP6|MUTL_RICBR DNA mismatch repair protein MutL OS=Rickettsia bellii (strain RML369-C) GN=mutL PE=3 SV=1 3 402 4.0E-29
sp|Q11L80|MUTL_CHESB DNA mismatch repair protein MutL OS=Chelativorans sp. (strain BNC1) GN=mutL PE=3 SV=1 4 349 4.0E-29
sp|Q0TRD5|MUTL_CLOP1 DNA mismatch repair protein MutL OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutL PE=3 SV=1 1 351 4.0E-29
sp|B3EHI9|MUTL_CHLL2 DNA mismatch repair protein MutL OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mutL PE=3 SV=1 1 367 5.0E-29
sp|B3PDC3|MUTL_CELJU DNA mismatch repair protein MutL OS=Cellvibrio japonicus (strain Ueda107) GN=mutL PE=3 SV=1 1 349 6.0E-29
sp|B0UUU5|MUTL_HISS2 DNA mismatch repair protein MutL OS=Histophilus somni (strain 2336) GN=mutL PE=3 SV=1 3 420 6.0E-29
sp|A8GY89|MUTL_RICB8 DNA mismatch repair protein MutL OS=Rickettsia bellii (strain OSU 85-389) GN=mutL PE=3 SV=1 3 350 6.0E-29
sp|Q11Z58|MUTL_CYTH3 DNA mismatch repair protein MutL OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mutL PE=3 SV=1 4 362 7.0E-29
sp|A6GYR1|MUTL_FLAPJ DNA mismatch repair protein MutL OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mutL PE=3 SV=1 2 348 7.0E-29
sp|A3D022|MUTL_SHEB5 DNA mismatch repair protein MutL OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mutL PE=3 SV=1 1 351 7.0E-29
sp|Q9ZC88|MUTL_RICPR DNA mismatch repair protein MutL OS=Rickettsia prowazekii (strain Madrid E) GN=mutL PE=3 SV=1 3 359 8.0E-29
sp|Q895H3|MUTL_CLOTE DNA mismatch repair protein MutL OS=Clostridium tetani (strain Massachusetts / E88) GN=mutL PE=3 SV=1 1 333 8.0E-29
sp|B1KSA2|MUTL_CLOBM DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutL PE=3 SV=1 1 351 8.0E-29
sp|Q9P7W6|MLH1_SCHPO Putative MutL protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlh1 PE=2 SV=1 2 338 9.0E-29
sp|A6WSV4|MUTL_SHEB8 DNA mismatch repair protein MutL OS=Shewanella baltica (strain OS185) GN=mutL PE=3 SV=1 1 351 1.0E-28
sp|A7FUK9|MUTL_CLOB1 DNA mismatch repair protein MutL OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutL PE=3 SV=1 1 351 1.0E-28
sp|Q74BP0|MUTL_GEOSL DNA mismatch repair protein MutL OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutL PE=3 SV=1 4 402 1.0E-28
sp|A9L3W1|MUTL_SHEB9 DNA mismatch repair protein MutL OS=Shewanella baltica (strain OS195) GN=mutL PE=3 SV=1 1 351 1.0E-28
sp|Q256F3|MUTL_CHLFF DNA mismatch repair protein MutL OS=Chlamydophila felis (strain Fe/C-56) GN=mutL PE=3 SV=1 4 160 1.0E-28
sp|C5BDM9|MUTL_EDWI9 DNA mismatch repair protein MutL OS=Edwardsiella ictaluri (strain 93-146) GN=mutL PE=3 SV=1 4 353 1.0E-28
sp|A5GEV5|MUTL_GEOUR DNA mismatch repair protein MutL OS=Geobacter uraniireducens (strain Rf4) GN=mutL PE=3 SV=1 1 400 2.0E-28
sp|C3KX34|MUTL_CLOB6 DNA mismatch repair protein MutL OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutL PE=3 SV=1 1 351 2.0E-28
sp|A7GE44|MUTL_CLOBL DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutL PE=3 SV=1 1 349 2.0E-28
sp|B1H0C7|MUTL_UNCTG DNA mismatch repair protein MutL OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=mutL PE=3 SV=1 4 349 2.0E-28
sp|Q8UHI3|MUTL_AGRFC DNA mismatch repair protein MutL OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutL PE=3 SV=2 4 426 2.0E-28
sp|A8GQA9|MUTL_RICAH DNA mismatch repair protein MutL OS=Rickettsia akari (strain Hartford) GN=mutL PE=3 SV=1 3 403 2.0E-28
sp|Q2GJE2|MUTL_ANAPZ DNA mismatch repair protein MutL OS=Anaplasma phagocytophilum (strain HZ) GN=mutL PE=3 SV=1 4 350 2.0E-28
sp|Q8EJ70|MUTL_SHEON DNA mismatch repair protein MutL OS=Shewanella oneidensis (strain MR-1) GN=mutL PE=3 SV=1 4 412 2.0E-28
sp|A6LWJ1|MUTL_CLOB8 DNA mismatch repair protein MutL OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mutL PE=3 SV=1 1 355 2.0E-28
sp|C3KDW1|MUTL_PSEFS DNA mismatch repair protein MutL OS=Pseudomonas fluorescens (strain SBW25) GN=mutL PE=3 SV=1 4 349 3.0E-28
sp|Q8XWB1|MUTL_RALSO DNA mismatch repair protein MutL OS=Ralstonia solanacearum (strain GMI1000) GN=mutL PE=3 SV=1 4 337 3.0E-28
sp|Q8Z187|MUTL_SALTI DNA mismatch repair protein MutL OS=Salmonella typhi GN=mutL PE=3 SV=1 4 432 3.0E-28
sp|A6SV55|MUTL_JANMA DNA mismatch repair protein MutL OS=Janthinobacterium sp. (strain Marseille) GN=mutL PE=3 SV=1 4 337 3.0E-28
sp|A5V3J3|MUTL_SPHWW DNA mismatch repair protein MutL OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutL PE=3 SV=1 3 351 3.0E-28
sp|Q0HMP1|MUTL_SHESM DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-4) GN=mutL PE=3 SV=1 4 351 3.0E-28
sp|Q0HR40|MUTL_SHESR DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-7) GN=mutL PE=3 SV=1 4 351 3.0E-28
sp|B6J016|MUTL_COXB2 DNA mismatch repair protein MutL OS=Coxiella burnetii (strain CbuG_Q212) GN=mutL PE=3 SV=1 1 351 3.0E-28
sp|Q5L4T7|MUTL_CHLAB DNA mismatch repair protein MutL OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutL PE=3 SV=1 4 160 3.0E-28
sp|A6X3F3|MUTL_OCHA4 DNA mismatch repair protein MutL OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutL PE=3 SV=1 4 426 3.0E-28
sp|Q9PFB8|MUTL_XYLFA DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain 9a5c) GN=mutL PE=3 SV=1 4 337 4.0E-28
sp|Q92FW6|MUTL_RICCN DNA mismatch repair protein MutL OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutL PE=3 SV=1 3 349 4.0E-28
sp|Q8KAX3|MUTL_CHLTE DNA mismatch repair protein MutL OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mutL PE=3 SV=1 1 338 4.0E-28
sp|P57886|MUTL_PASMU DNA mismatch repair protein MutL OS=Pasteurella multocida (strain Pm70) GN=mutL PE=3 SV=1 4 420 4.0E-28
sp|B3QL59|MUTL_CHLP8 DNA mismatch repair protein MutL OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutL PE=3 SV=1 1 426 4.0E-28
sp|Q88DD1|MUTL_PSEPK DNA mismatch repair protein MutL OS=Pseudomonas putida (strain KT2440) GN=mutL PE=3 SV=1 4 391 4.0E-28
sp|B8E280|MUTL_DICTD DNA mismatch repair protein MutL OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=mutL PE=3 SV=1 13 358 4.0E-28
sp|B0KKZ7|MUTL_PSEPG DNA mismatch repair protein MutL OS=Pseudomonas putida (strain GB-1) GN=mutL PE=3 SV=1 4 367 5.0E-28
sp|A8G8U7|MUTL_SERP5 DNA mismatch repair protein MutL OS=Serratia proteamaculans (strain 568) GN=mutL PE=3 SV=1 4 404 5.0E-28
sp|B4T2R5|MUTL_SALNS DNA mismatch repair protein MutL OS=Salmonella newport (strain SL254) GN=mutL PE=3 SV=1 4 401 6.0E-28
sp|A4VQP2|MUTL_PSEU5 DNA mismatch repair protein MutL OS=Pseudomonas stutzeri (strain A1501) GN=mutL PE=3 SV=1 4 366 6.0E-28
sp|A1BCW2|MUTL_CHLPD DNA mismatch repair protein MutL OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mutL PE=3 SV=1 1 338 6.0E-28
sp|A9KE32|MUTL_COXBN DNA mismatch repair protein MutL OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutL PE=3 SV=1 4 351 8.0E-28
sp|B1IM67|MUTL_CLOBK DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Okra / Type B1) GN=mutL PE=3 SV=1 1 351 9.0E-28
sp|Q5GSP0|MUTL_WOLTR DNA mismatch repair protein MutL OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mutL PE=3 SV=1 1 356 1.0E-27
sp|B2VCU8|MUTL_ERWT9 DNA mismatch repair protein MutL OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutL PE=3 SV=1 4 385 1.0E-27
sp|A8GU58|MUTL_RICRS DNA mismatch repair protein MutL OS=Rickettsia rickettsii (strain Sheila Smith) GN=mutL PE=3 SV=1 3 370 1.0E-27
sp|Q83CM9|MUTL_COXBU DNA mismatch repair protein MutL OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutL PE=3 SV=1 4 351 1.0E-27
sp|A9NCK3|MUTL_COXBR DNA mismatch repair protein MutL OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutL PE=3 SV=1 4 351 1.0E-27
sp|B0BVP7|MUTL_RICRO DNA mismatch repair protein MutL OS=Rickettsia rickettsii (strain Iowa) GN=mutL PE=3 SV=1 3 370 1.0E-27
sp|Q1ILN0|MUTL_KORVE DNA mismatch repair protein MutL OS=Koribacter versatilis (strain Ellin345) GN=mutL PE=3 SV=1 1 351 1.0E-27
sp|Q65SD7|MUTL_MANSM DNA mismatch repair protein MutL OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutL PE=3 SV=1 13 385 1.0E-27
sp|A6VN10|MUTL_ACTSZ DNA mismatch repair protein MutL OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mutL PE=3 SV=1 4 337 2.0E-27
sp|Q1GSN3|MUTL_SPHAL DNA mismatch repair protein MutL OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mutL PE=3 SV=1 3 351 2.0E-27
sp|A5UFN4|MUTL_HAEIG DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain PittGG) GN=mutL PE=3 SV=1 4 359 2.0E-27
sp|A1AT89|MUTL_PELPD DNA mismatch repair protein MutL OS=Pelobacter propionicus (strain DSM 2379) GN=mutL PE=3 SV=1 13 353 2.0E-27
sp|P44494|MUTL_HAEIN DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mutL PE=3 SV=1 4 359 3.0E-27
sp|Q87VJ2|MUTL_PSESM DNA mismatch repair protein MutL OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutL PE=3 SV=1 2 352 3.0E-27
sp|B5R0N7|MUTL_SALEP DNA mismatch repair protein MutL OS=Salmonella enteritidis PT4 (strain P125109) GN=mutL PE=3 SV=1 4 401 3.0E-27
sp|B5FRM6|MUTL_SALDC DNA mismatch repair protein MutL OS=Salmonella dublin (strain CT_02021853) GN=mutL PE=3 SV=1 4 401 3.0E-27
sp|C4K2Y5|MUTL_RICPU DNA mismatch repair protein MutL OS=Rickettsia peacockii (strain Rustic) GN=mutL PE=3 SV=1 3 370 3.0E-27
sp|C0Q6C7|MUTL_SALPC DNA mismatch repair protein MutL OS=Salmonella paratyphi C (strain RKS4594) GN=mutL PE=3 SV=1 4 401 3.0E-27
sp|B5R9B7|MUTL_SALG2 DNA mismatch repair protein MutL OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutL PE=3 SV=1 4 401 3.0E-27
sp|Q57GM1|MUTL_SALCH DNA mismatch repair protein MutL OS=Salmonella choleraesuis (strain SC-B67) GN=mutL PE=3 SV=1 4 401 3.0E-27
sp|B5BKH9|MUTL_SALPK DNA mismatch repair protein MutL OS=Salmonella paratyphi A (strain AKU_12601) GN=mutL PE=3 SV=1 4 401 3.0E-27
sp|Q5PL49|MUTL_SALPA DNA mismatch repair protein MutL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mutL PE=3 SV=1 4 401 3.0E-27
sp|C3PM22|MUTL_RICAE DNA mismatch repair protein MutL OS=Rickettsia africae (strain ESF-5) GN=mutL PE=3 SV=1 3 370 4.0E-27
sp|A8AMN1|MUTL_CITK8 DNA mismatch repair protein MutL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutL PE=3 SV=1 4 432 4.0E-27
sp|Q7MYT9|MUTL_PHOLL DNA mismatch repair protein MutL OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mutL PE=3 SV=1 3 336 4.0E-27
sp|Q4QPH7|MUTL_HAEI8 DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain 86-028NP) GN=mutL PE=3 SV=1 4 359 5.0E-27
sp|Q1I447|MUTL_PSEE4 DNA mismatch repair protein MutL OS=Pseudomonas entomophila (strain L48) GN=mutL PE=3 SV=1 4 363 5.0E-27
sp|B5F385|MUTL_SALA4 DNA mismatch repair protein MutL OS=Salmonella agona (strain SL483) GN=mutL PE=3 SV=1 4 401 6.0E-27
sp|B9M3N0|MUTL_GEODF DNA mismatch repair protein MutL OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mutL PE=3 SV=1 1 353 6.0E-27
sp|B1JAD6|MUTL_PSEPW DNA mismatch repair protein MutL OS=Pseudomonas putida (strain W619) GN=mutL PE=3 SV=1 4 352 6.0E-27
sp|A0KSR5|MUTL_SHESA DNA mismatch repair protein MutL OS=Shewanella sp. (strain ANA-3) GN=mutL PE=3 SV=1 4 351 6.0E-27
sp|A7MMA2|MUTL_CROS8 DNA mismatch repair protein MutL OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutL PE=3 SV=1 4 418 6.0E-27
sp|B4TSF0|MUTL_SALSV DNA mismatch repair protein MutL OS=Salmonella schwarzengrund (strain CVM19633) GN=mutL PE=3 SV=1 4 401 6.0E-27
sp|A9N4Y4|MUTL_SALPB DNA mismatch repair protein MutL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutL PE=3 SV=1 4 401 7.0E-27
sp|B4TFA4|MUTL_SALHS DNA mismatch repair protein MutL OS=Salmonella heidelberg (strain SL476) GN=mutL PE=3 SV=1 4 401 7.0E-27
sp|B5EGD4|MUTL_GEOBB DNA mismatch repair protein MutL OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mutL PE=3 SV=1 1 353 7.0E-27
sp|Q54KD8|MLH1_DICDI DNA mismatch repair protein Mlh1 OS=Dictyostelium discoideum GN=mlh1 PE=3 SV=1 4 351 8.0E-27
sp|B9JA11|MUTL_AGRRK DNA mismatch repair protein MutL OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=mutL PE=3 SV=1 3 351 9.0E-27
sp|P57633|MUTL_BUCAI DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mutL PE=3 SV=1 14 337 9.0E-27
sp|B8D8D4|MUTL_BUCA5 DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=mutL PE=3 SV=1 14 337 9.0E-27
sp|Q0T9M3|MUTL_ECOL5 DNA mismatch repair protein MutL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mutL PE=3 SV=1 4 368 9.0E-27
sp|A1AJ76|MUTL_ECOK1 DNA mismatch repair protein MutL OS=Escherichia coli O1:K1 / APEC GN=mutL PE=3 SV=1 4 368 9.0E-27
sp|B7MKX4|MUTL_ECO45 DNA mismatch repair protein MutL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mutL PE=3 SV=1 4 368 9.0E-27
sp|A4W5R1|MUTL_ENT38 DNA mismatch repair protein MutL OS=Enterobacter sp. (strain 638) GN=mutL PE=3 SV=1 4 433 9.0E-27
sp|C6E4L2|MUTL_GEOSM DNA mismatch repair protein MutL OS=Geobacter sp. (strain M21) GN=mutL PE=3 SV=1 1 353 9.0E-27
sp|B7IHA2|MUTL_THEAB DNA mismatch repair protein MutL OS=Thermosipho africanus (strain TCF52B) GN=mutL PE=3 SV=1 1 164 1.0E-26
sp|Q6D065|MUTL_PECAS DNA mismatch repair protein MutL OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutL PE=3 SV=1 4 425 1.0E-26
sp|B8D891|MUTL_BUCAT DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=mutL PE=3 SV=1 14 337 1.0E-26
sp|A5UB71|MUTL_HAEIE DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain PittEE) GN=mutL PE=3 SV=1 4 359 1.0E-26
sp|C6DFJ9|MUTL_PECCP DNA mismatch repair protein MutL OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutL PE=3 SV=1 4 336 1.0E-26
sp|B2ULE2|MUTL_AKKM8 DNA mismatch repair protein MutL OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=mutL PE=3 SV=1 1 350 1.0E-26
sp|B3QW86|MUTL_CHLT3 DNA mismatch repair protein MutL OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=mutL PE=3 SV=1 1 357 1.0E-26
sp|Q9Z794|MUTL_CHLPN DNA mismatch repair protein MutL OS=Chlamydia pneumoniae GN=mutL PE=3 SV=1 4 351 2.0E-26
sp|A9IN82|MUTL_BART1 DNA mismatch repair protein MutL OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutL PE=3 SV=1 4 400 2.0E-26
sp|Q67NL0|MUTL_SYMTH DNA mismatch repair protein MutL OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutL PE=3 SV=1 1 333 2.0E-26
sp|B7UQH9|MUTL_ECO27 DNA mismatch repair protein MutL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mutL PE=3 SV=1 4 432 2.0E-26
sp|P14161|MUTL_SALTY DNA mismatch repair protein MutL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutL PE=3 SV=1 4 371 2.0E-26
sp|B5Z2H6|MUTL_ECO5E DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mutL PE=3 SV=1 4 368 2.0E-26
sp|Q8FAK9|MUTL_ECOL6 DNA mismatch repair protein MutL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mutL PE=3 SV=2 4 368 2.0E-26
sp|B7MSY3|MUTL_ECO81 DNA mismatch repair protein MutL OS=Escherichia coli O81 (strain ED1a) GN=mutL PE=3 SV=1 4 368 2.0E-26
sp|A8F560|MUTL_PSELT DNA mismatch repair protein MutL OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mutL PE=3 SV=1 4 188 2.0E-26
sp|Q8XDN4|MUTL_ECO57 DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 GN=mutL PE=3 SV=1 4 368 2.0E-26
sp|B1LQJ0|MUTL_ECOSM DNA mismatch repair protein MutL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mutL PE=3 SV=1 4 368 2.0E-26
sp|Q5E2C6|MUTL_VIBF1 DNA mismatch repair protein MutL OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mutL PE=3 SV=1 4 349 3.0E-26
sp|O67518|MUTL_AQUAE DNA mismatch repair protein MutL OS=Aquifex aeolicus (strain VF5) GN=mutL PE=3 SV=1 15 346 3.0E-26
sp|Q328E9|MUTL_SHIDS DNA mismatch repair protein MutL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mutL PE=3 SV=1 4 368 3.0E-26
sp|A6TH85|MUTL_KLEP7 DNA mismatch repair protein MutL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mutL PE=3 SV=1 4 336 3.0E-26
sp|B5FBR6|MUTL_VIBFM DNA mismatch repair protein MutL OS=Vibrio fischeri (strain MJ11) GN=mutL PE=3 SV=1 4 349 3.0E-26
sp|B5YE42|MUTL_DICT6 DNA mismatch repair protein MutL OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=mutL PE=3 SV=1 13 358 3.0E-26
sp|B2IYW1|MUTL_NOSP7 DNA mismatch repair protein MutL OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mutL PE=3 SV=1 2 350 3.0E-26
sp|Q0SXB2|MUTL_SHIF8 DNA mismatch repair protein MutL OS=Shigella flexneri serotype 5b (strain 8401) GN=mutL PE=3 SV=1 4 368 4.0E-26
sp|A7HC45|MUTL_ANADF DNA mismatch repair protein MutL OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mutL PE=3 SV=1 1 355 4.0E-26
sp|Q97I20|MUTL_CLOAB DNA mismatch repair protein MutL OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutL PE=3 SV=1 4 365 4.0E-26
sp|Q83P35|MUTL_SHIFL DNA mismatch repair protein MutL OS=Shigella flexneri GN=mutL PE=3 SV=4 4 368 4.0E-26
sp|Q68VN4|MUTL_RICTY DNA mismatch repair protein MutL OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mutL PE=3 SV=1 3 410 4.0E-26
sp|A8F0A4|MUTL_RICCK DNA mismatch repair protein MutL OS=Rickettsia canadensis (strain McKiel) GN=mutL PE=3 SV=1 3 349 4.0E-26
sp|B7NGA4|MUTL_ECOLU DNA mismatch repair protein MutL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mutL PE=3 SV=1 4 368 4.0E-26
sp|B5RR29|MUTL_BORRA DNA mismatch repair protein MutL OS=Borrelia recurrentis (strain A1) GN=mutL PE=3 SV=1 1 360 5.0E-26
sp|B6EMQ9|MUTL_ALISL DNA mismatch repair protein MutL OS=Aliivibrio salmonicida (strain LFI1238) GN=mutL PE=3 SV=1 4 349 5.0E-26
sp|Q3A504|MUTL_PELCD DNA mismatch repair protein MutL OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutL PE=3 SV=1 13 426 5.0E-26
sp|Q31TA0|MUTL_SHIBS DNA mismatch repair protein MutL OS=Shigella boydii serotype 4 (strain Sb227) GN=mutL PE=3 SV=1 4 368 5.0E-26
sp|B1IT36|MUTL_ECOLC DNA mismatch repair protein MutL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mutL PE=3 SV=1 4 368 5.0E-26
sp|B5Y334|MUTL_KLEP3 DNA mismatch repair protein MutL OS=Klebsiella pneumoniae (strain 342) GN=mutL PE=3 SV=1 4 336 6.0E-26
sp|B7LLV2|MUTL_ESCF3 DNA mismatch repair protein MutL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mutL PE=3 SV=1 4 368 6.0E-26
sp|A9MFP2|MUTL_SALAR DNA mismatch repair protein MutL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutL PE=3 SV=1 4 387 7.0E-26
sp|B3E5Z2|MUTL_GEOLS DNA mismatch repair protein MutL OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutL PE=3 SV=1 4 353 7.0E-26
sp|Q2GDF7|MUTL_NEOSM DNA mismatch repair protein MutL OS=Neorickettsia sennetsu (strain Miyayama) GN=mutL PE=3 SV=1 12 337 7.0E-26
sp|P74925|MUTL_THEMA DNA mismatch repair protein MutL OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mutL PE=3 SV=1 4 376 7.0E-26
sp|B7M8T0|MUTL_ECO8A DNA mismatch repair protein MutL OS=Escherichia coli O8 (strain IAI1) GN=mutL PE=3 SV=1 4 368 8.0E-26
sp|B6I274|MUTL_ECOSE DNA mismatch repair protein MutL OS=Escherichia coli (strain SE11) GN=mutL PE=3 SV=1 4 368 9.0E-26
sp|A8A7R4|MUTL_ECOHS DNA mismatch repair protein MutL OS=Escherichia coli O9:H4 (strain HS) GN=mutL PE=3 SV=1 4 368 9.0E-26
sp|A7ZV39|MUTL_ECO24 DNA mismatch repair protein MutL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mutL PE=3 SV=1 4 368 9.0E-26
sp|Q3YUH3|MUTL_SHISS DNA mismatch repair protein MutL OS=Shigella sonnei (strain Ss046) GN=mutL PE=3 SV=1 4 368 1.0E-25
sp|B2TY45|MUTL_SHIB3 DNA mismatch repair protein MutL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutL PE=3 SV=1 4 368 1.0E-25
sp|P23367|MUTL_ECOLI DNA mismatch repair protein MutL OS=Escherichia coli (strain K12) GN=mutL PE=1 SV=2 4 368 1.0E-25
sp|B1XDS1|MUTL_ECODH DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / DH10B) GN=mutL PE=3 SV=1 4 368 1.0E-25
sp|C5A1G1|MUTL_ECOBW DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mutL PE=3 SV=1 4 368 1.0E-25
sp|B7LC24|MUTL_ECO55 DNA mismatch repair protein MutL OS=Escherichia coli (strain 55989 / EAEC) GN=mutL PE=3 SV=1 4 368 1.0E-25
sp|A6LL30|MUTL_THEM4 DNA mismatch repair protein MutL OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mutL PE=3 SV=1 1 330 1.0E-25
sp|B5RL36|MUTL_BORDL DNA mismatch repair protein MutL OS=Borrelia duttonii (strain Ly) GN=mutL PE=3 SV=1 1 360 1.0E-25
sp|B9K7B8|MUTL_THENN DNA mismatch repair protein MutL OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mutL PE=3 SV=1 4 350 1.0E-25
sp|Q3MEV6|MUTL_ANAVT DNA mismatch repair protein MutL OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutL PE=3 SV=1 2 401 2.0E-25
sp|B5YIZ6|MUTL_THEYD DNA mismatch repair protein MutL OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutL PE=3 SV=1 1 333 2.0E-25
sp|Q2IIL0|MUTL_ANADE DNA mismatch repair protein MutL OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutL PE=3 SV=1 1 372 2.0E-25
sp|B3EL44|MUTL_CHLPB DNA mismatch repair protein MutL OS=Chlorobium phaeobacteroides (strain BS1) GN=mutL PE=3 SV=1 13 338 2.0E-25
sp|Q983L2|MUTL_RHILO DNA mismatch repair protein MutL OS=Rhizobium loti (strain MAFF303099) GN=mutL PE=3 SV=1 4 351 2.0E-25
sp|A9BJB9|MUTL_PETMO DNA mismatch repair protein MutL OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mutL PE=3 SV=1 4 351 2.0E-25
sp|Q2LUR5|MUTL_SYNAS DNA mismatch repair protein MutL OS=Syntrophus aciditrophicus (strain SB) GN=mutL PE=3 SV=1 13 358 3.0E-25
sp|A1SZL2|MUTL_PSYIN DNA mismatch repair protein MutL OS=Psychromonas ingrahamii (strain 37) GN=mutL PE=3 SV=1 4 351 3.0E-25
sp|Q1QY28|MUTL_CHRSD DNA mismatch repair protein MutL OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutL PE=3 SV=1 4 352 6.0E-25
sp|O51229|MUTL_BORBU DNA mismatch repair protein MutL OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutL PE=3 SV=1 1 360 8.0E-25
sp|B5ZS00|MUTL_RHILW DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=mutL PE=3 SV=1 4 351 9.0E-25
sp|Q0SNV1|MUTL_BORAP DNA mismatch repair protein MutL OS=Borrelia afzelii (strain PKo) GN=mutL PE=3 SV=1 1 454 9.0E-25
sp|C1F876|MUTL_ACIC5 DNA mismatch repair protein MutL OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=mutL PE=3 SV=1 1 349 1.0E-24
sp|Q48A24|MUTL_COLP3 DNA mismatch repair protein MutL OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mutL PE=3 SV=1 3 357 1.0E-24
sp|Q2GFV4|MUTL_EHRCR DNA mismatch repair protein MutL OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mutL PE=3 SV=1 3 353 1.0E-24
sp|Q2KBX7|MUTL_RHIEC DNA mismatch repair protein MutL OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutL PE=3 SV=1 3 351 1.0E-24
sp|B8J9F5|MUTL_ANAD2 DNA mismatch repair protein MutL OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutL PE=3 SV=1 1 345 1.0E-24
sp|B4UCW3|MUTL_ANASK DNA mismatch repair protein MutL OS=Anaeromyxobacter sp. (strain K) GN=mutL PE=3 SV=1 1 345 2.0E-24
sp|Q1MKU7|MUTL_RHIL3 DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutL PE=3 SV=1 4 351 2.0E-24
sp|A5FW68|MUTL_ACICJ DNA mismatch repair protein MutL OS=Acidiphilium cryptum (strain JF-5) GN=mutL PE=3 SV=1 4 330 3.0E-24
sp|C3MGW0|MUTL_RHISN DNA mismatch repair protein MutL OS=Rhizobium sp. (strain NGR234) GN=mutL PE=3 SV=1 4 379 3.0E-24
sp|B3PRD9|MUTL_RHIE6 DNA mismatch repair protein MutL OS=Rhizobium etli (strain CIAT 652) GN=mutL PE=3 SV=1 3 351 3.0E-24
sp|B4F203|MUTL_PROMH DNA mismatch repair protein MutL OS=Proteus mirabilis (strain HI4320) GN=mutL PE=3 SV=1 13 337 5.0E-24
sp|A1UU01|MUTL_BARBK DNA mismatch repair protein MutL OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutL PE=3 SV=1 4 351 5.0E-24
sp|Q92RP4|MUTL_RHIME DNA mismatch repair protein MutL OS=Rhizobium meliloti (strain 1021) GN=mutL PE=3 SV=1 4 350 5.0E-24
sp|A1QZ05|MUTL_BORT9 DNA mismatch repair protein MutL OS=Borrelia turicatae (strain 91E135) GN=mutL PE=3 SV=1 1 356 6.0E-24
sp|Q6G0J4|MUTL_BARQU DNA mismatch repair protein MutL OS=Bartonella quintana (strain Toulouse) GN=mutL PE=3 SV=1 4 389 6.0E-24
sp|Q662F3|MUTL_BORBP DNA mismatch repair protein MutL OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutL PE=3 SV=1 1 433 6.0E-24
sp|B0BTY3|MUTL_ACTPJ DNA mismatch repair protein MutL OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mutL PE=3 SV=1 13 342 7.0E-24
sp|A8I6D2|MUTL_AZOC5 DNA mismatch repair protein MutL OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutL PE=3 SV=1 3 367 7.0E-24
sp|A0LJK2|MUTL_SYNFM DNA mismatch repair protein MutL OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutL PE=3 SV=1 1 351 7.0E-24
sp|A4Z0Q5|MUTL_BRASO DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain ORS278) GN=mutL PE=3 SV=1 4 424 9.0E-24
sp|C4L9N1|MUTL_TOLAT DNA mismatch repair protein MutL OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=mutL PE=3 SV=1 13 355 9.0E-24
sp|Q6G4R4|MUTL_BARHE DNA mismatch repair protein MutL OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mutL PE=3 SV=1 4 351 1.0E-23
sp|Q1D568|MUTL_MYXXD DNA mismatch repair protein MutL OS=Myxococcus xanthus (strain DK 1622) GN=mutL PE=3 SV=1 1 353 1.0E-23
sp|A5ECL8|MUTL_BRASB DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutL PE=3 SV=1 4 351 1.0E-23
sp|C5CF28|MUTL_KOSOT DNA mismatch repair protein MutL OS=Kosmotoga olearia (strain TBF 19.5.1) GN=mutL PE=3 SV=1 4 349 2.0E-23
sp|Q1LSQ2|MUTL_BAUCH DNA mismatch repair protein MutL OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=mutL PE=3 SV=1 4 161 2.0E-23
sp|Q2VYV5|MUTL_MAGSA DNA mismatch repair protein MutL OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutL PE=3 SV=1 3 339 3.0E-23
sp|Q3SIQ5|MUTL_THIDA DNA mismatch repair protein MutL OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutL PE=3 SV=1 3 337 3.0E-23
sp|C0QSY6|MUTL_PERMH DNA mismatch repair protein MutL OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mutL PE=3 SV=1 1 352 4.0E-23
sp|A6U6K5|MUTL_SINMW DNA mismatch repair protein MutL OS=Sinorhizobium medicae (strain WSM419) GN=mutL PE=3 SV=1 4 351 4.0E-23
sp|Q9PJG5|MUTL_CHLMU DNA mismatch repair protein MutL OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mutL PE=3 SV=1 4 160 4.0E-23
sp|Q7VN43|MUTL_HAEDU DNA mismatch repair protein MutL OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutL PE=3 SV=1 13 371 5.0E-23
sp|A0KGR9|MUTL_AERHH DNA mismatch repair protein MutL OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mutL PE=3 SV=1 13 349 7.0E-23
sp|Q3SPJ0|MUTL_NITWN DNA mismatch repair protein MutL OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutL PE=3 SV=1 4 364 8.0E-23
sp|Q89DE6|MUTL_BRADU DNA mismatch repair protein MutL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutL PE=3 SV=1 4 339 1.0E-22
sp|A1JIR3|MUTL_YERE8 DNA mismatch repair protein MutL OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mutL PE=3 SV=1 4 408 2.0E-22
sp|A7FMY1|MUTL_YERP3 DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|B1JMP1|MUTL_YERPY DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|Q66FB7|MUTL_YERPS DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|A4TRP1|MUTL_YERPP DNA mismatch repair protein MutL OS=Yersinia pestis (strain Pestoides F) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|Q1CEF3|MUTL_YERPN DNA mismatch repair protein MutL OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|Q8ZIW4|MUTL_YERPE DNA mismatch repair protein MutL OS=Yersinia pestis GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|B2K202|MUTL_YERPB DNA mismatch repair protein MutL OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|Q1C0Z8|MUTL_YERPA DNA mismatch repair protein MutL OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|A9QYN3|MUTL_YERPG DNA mismatch repair protein MutL OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mutL PE=3 SV=1 4 353 2.0E-22
sp|Q88UZ8|MUTL_LACPL DNA mismatch repair protein MutL OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutL PE=3 SV=1 1 377 3.0E-22
sp|Q219I5|MUTL_RHOPB DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB18) GN=mutL PE=3 SV=1 4 351 3.0E-22
sp|B0SWX9|MUTL_CAUSK DNA mismatch repair protein MutL OS=Caulobacter sp. (strain K31) GN=mutL PE=3 SV=1 4 350 4.0E-22
sp|Q89A38|MUTL_BUCBP DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mutL PE=3 SV=1 4 164 4.0E-22
sp|B0JS91|MUTL_MICAN DNA mismatch repair protein MutL OS=Microcystis aeruginosa (strain NIES-843) GN=mutL PE=3 SV=1 4 361 6.0E-22
sp|B4RA70|MUTL_PHEZH DNA mismatch repair protein MutL OS=Phenylobacterium zucineum (strain HLK1) GN=mutL PE=3 SV=1 4 350 8.0E-22
sp|O84579|MUTL_CHLTR DNA mismatch repair protein MutL OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mutL PE=3 SV=1 4 160 8.0E-22
sp|Q3KLC2|MUTL_CHLTA DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=mutL PE=3 SV=1 4 160 8.0E-22
sp|B0BA28|MUTL_CHLTB DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mutL PE=3 SV=1 4 160 8.0E-22
sp|B0B8E9|MUTL_CHLT2 DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mutL PE=3 SV=1 4 160 8.0E-22
sp|B2II71|MUTL_BEII9 DNA mismatch repair protein MutL OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=mutL PE=3 SV=1 3 351 1.0E-21
sp|Q3IDU0|MUTL_PSEHT DNA mismatch repair protein MutL OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mutL PE=3 SV=1 3 171 1.0E-21
sp|Q2RQ52|MUTL_RHORT DNA mismatch repair protein MutL OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutL PE=3 SV=1 3 350 1.0E-21
sp|B7JY11|MUTL_CYAP8 DNA mismatch repair protein MutL OS=Cyanothece sp. (strain PCC 8801) GN=mutL PE=3 SV=1 4 363 2.0E-21
sp|O83325|MUTL_TREPA DNA mismatch repair protein MutL OS=Treponema pallidum (strain Nichols) GN=mutL PE=3 SV=2 11 166 2.0E-21
sp|A4SR27|MUTL_AERS4 DNA mismatch repair protein MutL OS=Aeromonas salmonicida (strain A449) GN=mutL PE=3 SV=1 13 349 2.0E-21
sp|Q8K913|MUTL_BUCAP DNA mismatch repair protein MutL OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mutL PE=3 SV=1 1 336 4.0E-21
sp|B9JSD6|MUTL_AGRVS DNA mismatch repair protein MutL OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=mutL PE=3 SV=1 3 351 4.0E-21
sp|P70754|MUTL_AQUPY DNA mismatch repair protein MutL OS=Aquifex pyrophilus GN=mutL PE=3 SV=1 4 203 5.0E-21
sp|Q131I8|MUTL_RHOPS DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB5) GN=mutL PE=3 SV=1 4 351 5.0E-21
sp|Q5QW89|MUTL_IDILO DNA mismatch repair protein MutL OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutL PE=3 SV=1 3 358 6.0E-21
sp|Q07980|MLH2_YEAST DNA mismatch repair protein MLH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH2 PE=1 SV=1 11 354 7.0E-21
sp|B6JIV1|MUTL_OLICO DNA mismatch repair protein MutL OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=mutL PE=3 SV=1 4 339 1.0E-20
sp|Q2ISE2|MUTL_RHOP2 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain HaA2) GN=mutL PE=3 SV=1 4 351 1.0E-20
sp|B3Q7Y9|MUTL_RHOPT DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain TIE-1) GN=mutL PE=3 SV=1 4 339 2.0E-20
sp|P0CAV5|MUTL_CAUCR DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutL PE=3 SV=1 4 395 4.0E-20
sp|B8H173|MUTL_CAUCN DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mutL PE=3 SV=1 4 395 4.0E-20
sp|Q6N1N4|MUTL_RHOPA DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutL PE=3 SV=1 4 339 4.0E-20
sp|B8ETE4|MUTL_METSB DNA mismatch repair protein MutL OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=mutL PE=3 SV=1 4 361 4.0E-19
sp|B1X109|MUTL_CYAA5 DNA mismatch repair protein MutL OS=Cyanothece sp. (strain ATCC 51142) GN=mutL PE=3 SV=1 4 193 4.0E-19
sp|Q1QIP3|MUTL_NITHX DNA mismatch repair protein MutL OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutL PE=3 SV=1 4 351 6.0E-19
sp|Q9RA54|MUTL_THET8 DNA mismatch repair protein MutL OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mutL PE=3 SV=2 3 304 1.0E-18
sp|Q72J22|MUTL_THET2 DNA mismatch repair protein MutL OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mutL PE=3 SV=1 3 304 2.0E-18
sp|Q07RR2|MUTL_RHOP5 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisA53) GN=mutL PE=3 SV=1 4 384 2.0E-18
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 1 233 2.0E-18
sp|Q97I20|MUTL_CLOAB DNA mismatch repair protein MutL OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutL PE=3 SV=1 593 882 5.0E-17
sp|Q13670|PM2PB_HUMAN Putative postmeiotic segregation increased 2-like protein 11 OS=Homo sapiens GN=PMS2P11 PE=5 SV=1 4 74 2.0E-16
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 4 285 3.0E-16
sp|P96082|MUTL_THEAQ DNA mismatch repair protein MutL OS=Thermus aquaticus GN=mutL PE=3 SV=1 3 304 7.0E-16
sp|Q13401|PM2P3_HUMAN Putative postmeiotic segregation increased 2-like protein 3 OS=Homo sapiens GN=PMS2P3 PE=5 SV=2 4 72 1.0E-15
sp|A0Q0M7|MUTL_CLONN DNA mismatch repair protein MutL OS=Clostridium novyi (strain NT) GN=mutL PE=3 SV=1 680 881 2.0E-15
sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens GN=MLH3 PE=1 SV=3 4 360 3.0E-15
sp|A3CWX7|MUTL_METMJ DNA mismatch repair protein MutL OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=mutL PE=3 SV=1 718 888 4.0E-14
sp|C4ZA52|MUTL_EUBR3 DNA mismatch repair protein MutL OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=mutL PE=3 SV=1 716 885 1.0E-13
sp|B3E5Z2|MUTL_GEOLS DNA mismatch repair protein MutL OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutL PE=3 SV=1 676 881 1.0E-13
sp|Q9HSM6|MUTL_HALSA DNA mismatch repair protein MutL OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mutL PE=3 SV=1 683 878 3.0E-13
sp|B0R2S6|MUTL_HALS3 DNA mismatch repair protein MutL OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mutL PE=3 SV=1 683 878 3.0E-13
sp|Q3ACA6|MUTL_CARHZ DNA mismatch repair protein MutL OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutL PE=3 SV=1 671 881 4.0E-13
sp|C1FNT8|MUTL_CLOBJ DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutL PE=3 SV=1 683 878 4.0E-13
sp|A7GE44|MUTL_CLOBL DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutL PE=3 SV=1 683 878 1.0E-12
sp|B5EGD4|MUTL_GEOBB DNA mismatch repair protein MutL OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mutL PE=3 SV=1 678 881 1.0E-12
sp|A7FUK9|MUTL_CLOB1 DNA mismatch repair protein MutL OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutL PE=3 SV=1 683 878 2.0E-12
sp|B1IM67|MUTL_CLOBK DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Okra / Type B1) GN=mutL PE=3 SV=1 683 878 2.0E-12
sp|C6E4L2|MUTL_GEOSM DNA mismatch repair protein MutL OS=Geobacter sp. (strain M21) GN=mutL PE=3 SV=1 675 881 2.0E-12
sp|B4RLX4|MUTL_NEIG2 DNA mismatch repair protein MutL OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mutL PE=3 SV=1 691 877 6.0E-12
sp|Q5F8M6|MUTL_NEIG1 DNA mismatch repair protein MutL OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mutL PE=1 SV=1 691 877 6.0E-12
sp|B1KSA2|MUTL_CLOBM DNA mismatch repair protein MutL OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutL PE=3 SV=1 683 878 6.0E-12
sp|C3KX34|MUTL_CLOB6 DNA mismatch repair protein MutL OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutL PE=3 SV=1 683 878 6.0E-12
sp|Q983L2|MUTL_RHILO DNA mismatch repair protein MutL OS=Rhizobium loti (strain MAFF303099) GN=mutL PE=3 SV=1 691 881 1.0E-11
sp|C0R515|MUTL_WOLWR DNA mismatch repair protein MutL OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mutL PE=3 SV=1 658 877 5.0E-11
sp|Q1ILN0|MUTL_KORVE DNA mismatch repair protein MutL OS=Koribacter versatilis (strain Ellin345) GN=mutL PE=3 SV=1 653 878 5.0E-11
sp|B9M3N0|MUTL_GEODF DNA mismatch repair protein MutL OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mutL PE=3 SV=1 675 881 5.0E-11
sp|Q8XL86|MUTL_CLOPE DNA mismatch repair protein MutL OS=Clostridium perfringens (strain 13 / Type A) GN=mutL PE=3 SV=1 673 878 6.0E-11
sp|Q5GSP0|MUTL_WOLTR DNA mismatch repair protein MutL OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mutL PE=3 SV=1 691 877 6.0E-11
sp|Q0TRD5|MUTL_CLOP1 DNA mismatch repair protein MutL OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutL PE=3 SV=1 673 878 7.0E-11
sp|B0TB10|MUTL_HELMI DNA mismatch repair protein MutL OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mutL PE=3 SV=1 678 883 8.0E-11
sp|B4SGC3|MUTL_PELPB DNA mismatch repair protein MutL OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=mutL PE=3 SV=1 718 881 1.0E-10
sp|Q01QW7|MUTL_SOLUE DNA mismatch repair protein MutL OS=Solibacter usitatus (strain Ellin6076) GN=mutL PE=3 SV=1 683 880 1.0E-10
sp|A1KUP6|MUTL_NEIMF DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mutL PE=3 SV=1 691 877 1.0E-10
sp|A5GEV5|MUTL_GEOUR DNA mismatch repair protein MutL OS=Geobacter uraniireducens (strain Rf4) GN=mutL PE=3 SV=1 676 881 1.0E-10
sp|Q9JTS2|MUTL_NEIMA DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mutL PE=3 SV=1 691 877 2.0E-10
sp|Q9JYT2|MUTL_NEIMB DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutL PE=3 SV=1 691 877 2.0E-10
sp|Q219I5|MUTL_RHOPB DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB18) GN=mutL PE=3 SV=1 696 881 2.0E-10
sp|Q6N1N4|MUTL_RHOPA DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutL PE=3 SV=1 696 882 2.0E-10
sp|A6TR78|MUTL_ALKMQ DNA mismatch repair protein MutL OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutL PE=3 SV=1 718 883 3.0E-10
sp|A4SGM5|MUTL_CHLPM DNA mismatch repair protein MutL OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mutL PE=3 SV=1 718 878 3.0E-10
sp|B1H0C7|MUTL_UNCTG DNA mismatch repair protein MutL OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=mutL PE=3 SV=1 695 877 3.0E-10
sp|Q131I8|MUTL_RHOPS DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB5) GN=mutL PE=3 SV=1 696 882 3.0E-10
sp|Q07RR2|MUTL_RHOP5 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisA53) GN=mutL PE=3 SV=1 696 881 3.0E-10
sp|Q0STR3|MUTL_CLOPS DNA mismatch repair protein MutL OS=Clostridium perfringens (strain SM101 / Type A) GN=mutL PE=3 SV=1 674 878 4.0E-10
sp|Q89DE6|MUTL_BRADU DNA mismatch repair protein MutL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutL PE=3 SV=1 696 881 4.0E-10
sp|Q2ISE2|MUTL_RHOP2 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain HaA2) GN=mutL PE=3 SV=1 696 882 4.0E-10
sp|A1AT89|MUTL_PELPD DNA mismatch repair protein MutL OS=Pelobacter propionicus (strain DSM 2379) GN=mutL PE=3 SV=1 677 877 5.0E-10
sp|Q1QIP3|MUTL_NITHX DNA mismatch repair protein MutL OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutL PE=3 SV=1 696 881 5.0E-10
sp|A9M0G1|MUTL_NEIM0 DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup C (strain 053442) GN=mutL PE=3 SV=1 691 877 7.0E-10
sp|Q74BP0|MUTL_GEOSL DNA mismatch repair protein MutL OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutL PE=3 SV=1 678 881 8.0E-10
sp|B3QL59|MUTL_CHLP8 DNA mismatch repair protein MutL OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutL PE=3 SV=1 718 881 8.0E-10
sp|B3EL44|MUTL_CHLPB DNA mismatch repair protein MutL OS=Chlorobium phaeobacteroides (strain BS1) GN=mutL PE=3 SV=1 718 878 8.0E-10
sp|B0SWX9|MUTL_CAUSK DNA mismatch repair protein MutL OS=Caulobacter sp. (strain K31) GN=mutL PE=3 SV=1 689 881 8.0E-10
sp|B3Q7Y9|MUTL_RHOPT DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain TIE-1) GN=mutL PE=3 SV=1 696 882 8.0E-10
sp|P0CAV5|MUTL_CAUCR DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutL PE=3 SV=1 696 881 8.0E-10
sp|B8H173|MUTL_CAUCN DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mutL PE=3 SV=1 696 881 8.0E-10
sp|Q8KAX3|MUTL_CHLTE DNA mismatch repair protein MutL OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mutL PE=3 SV=1 718 881 9.0E-10
sp|A5ECL8|MUTL_BRASB DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutL PE=3 SV=1 696 881 1.0E-09
sp|B4RA70|MUTL_PHEZH DNA mismatch repair protein MutL OS=Phenylobacterium zucineum (strain HLK1) GN=mutL PE=3 SV=1 696 881 1.0E-09
sp|Q5WFY4|MUTL_BACSK DNA mismatch repair protein MutL OS=Bacillus clausii (strain KSM-K16) GN=mutL PE=3 SV=1 718 881 2.0E-09
sp|Q9PFB8|MUTL_XYLFA DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain 9a5c) GN=mutL PE=3 SV=1 716 877 2.0E-09
sp|B5YIZ6|MUTL_THEYD DNA mismatch repair protein MutL OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutL PE=3 SV=1 680 887 2.0E-09
sp|A4Z0Q5|MUTL_BRASO DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain ORS278) GN=mutL PE=3 SV=1 696 881 2.0E-09
sp|Q3SPJ0|MUTL_NITWN DNA mismatch repair protein MutL OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutL PE=3 SV=1 696 881 2.0E-09
sp|B9JSD6|MUTL_AGRVS DNA mismatch repair protein MutL OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=mutL PE=3 SV=1 687 881 2.0E-09
sp|B0U5C6|MUTL_XYLFM DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M12) GN=mutL PE=3 SV=1 716 877 3.0E-09
sp|A8I6D2|MUTL_AZOC5 DNA mismatch repair protein MutL OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutL PE=3 SV=1 696 878 3.0E-09
sp|A9VS12|MUTL_BACWK DNA mismatch repair protein MutL OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutL PE=3 SV=1 718 880 4.0E-09
sp|Q035Z3|MUTL_LACC3 DNA mismatch repair protein MutL OS=Lactobacillus casei (strain ATCC 334) GN=mutL PE=3 SV=1 716 881 4.0E-09
sp|A4J5Q3|MUTL_DESRM DNA mismatch repair protein MutL OS=Desulfotomaculum reducens (strain MI-1) GN=mutL PE=3 SV=1 718 878 4.0E-09
sp|B9JA11|MUTL_AGRRK DNA mismatch repair protein MutL OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=mutL PE=3 SV=1 716 881 4.0E-09
sp|C5CF28|MUTL_KOSOT DNA mismatch repair protein MutL OS=Kosmotoga olearia (strain TBF 19.5.1) GN=mutL PE=3 SV=1 716 885 4.0E-09
sp|A8MQ11|PM2P5_HUMAN Postmeiotic segregation increased 2-like protein 5 OS=Homo sapiens GN=PMS2P5 PE=5 SV=2 106 170 4.0E-09
sp|B3W9W3|MUTL_LACCB DNA mismatch repair protein MutL OS=Lactobacillus casei (strain BL23) GN=mutL PE=3 SV=1 716 881 5.0E-09
sp|C1ENZ2|MUTL_BACC3 DNA mismatch repair protein MutL OS=Bacillus cereus (strain 03BB102) GN=mutL PE=3 SV=1 718 880 5.0E-09
sp|Q6HF47|MUTL_BACHK DNA mismatch repair protein MutL OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutL PE=3 SV=1 718 880 5.0E-09
sp|Q81A26|MUTL_BACCR DNA mismatch repair protein MutL OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutL PE=3 SV=1 718 880 5.0E-09
sp|B7HDP3|MUTL_BACC4 DNA mismatch repair protein MutL OS=Bacillus cereus (strain B4264) GN=mutL PE=3 SV=1 718 880 5.0E-09
sp|Q3AUA2|MUTL_CHLCH DNA mismatch repair protein MutL OS=Chlorobium chlorochromatii (strain CaD3) GN=mutL PE=3 SV=1 718 881 5.0E-09
sp|B8CX97|MUTL_HALOH DNA mismatch repair protein MutL OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutL PE=3 SV=1 640 882 5.0E-09
sp|B3EHI9|MUTL_CHLL2 DNA mismatch repair protein MutL OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mutL PE=3 SV=1 718 882 5.0E-09
sp|B6JIV1|MUTL_OLICO DNA mismatch repair protein MutL OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=mutL PE=3 SV=1 716 881 5.0E-09
sp|B7ITM0|MUTL_BACC2 DNA mismatch repair protein MutL OS=Bacillus cereus (strain G9842) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|B9IV58|MUTL_BACCQ DNA mismatch repair protein MutL OS=Bacillus cereus (strain Q1) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|Q732V8|MUTL_BACC1 DNA mismatch repair protein MutL OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|A0RHE0|MUTL_BACAH DNA mismatch repair protein MutL OS=Bacillus thuringiensis (strain Al Hakam) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|Q81WR4|MUTL_BACAN DNA mismatch repair protein MutL OS=Bacillus anthracis GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|C3L823|MUTL_BACAC DNA mismatch repair protein MutL OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|C3P5H4|MUTL_BACAA DNA mismatch repair protein MutL OS=Bacillus anthracis (strain A0248) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|B7HLA2|MUTL_BACC7 DNA mismatch repair protein MutL OS=Bacillus cereus (strain AH187) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|Q636Q8|MUTL_BACCZ DNA mismatch repair protein MutL OS=Bacillus cereus (strain ZK / E33L) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|B7JJ46|MUTL_BACC0 DNA mismatch repair protein MutL OS=Bacillus cereus (strain AH820) GN=mutL PE=3 SV=1 718 880 6.0E-09
sp|Q11L80|MUTL_CHESB DNA mismatch repair protein MutL OS=Chelativorans sp. (strain BNC1) GN=mutL PE=3 SV=1 696 881 7.0E-09
sp|Q87AC9|MUTL_XYLFT DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutL PE=3 SV=1 716 877 9.0E-09
sp|B2I9E6|MUTL_XYLF2 DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M23) GN=mutL PE=3 SV=1 716 877 9.0E-09
sp|Q2LUR5|MUTL_SYNAS DNA mismatch repair protein MutL OS=Syntrophus aciditrophicus (strain SB) GN=mutL PE=3 SV=1 716 877 9.0E-09
sp|Q2KBX7|MUTL_RHIEC DNA mismatch repair protein MutL OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutL PE=3 SV=1 686 881 9.0E-09
sp|A2SSN1|MUTL_METLZ DNA mismatch repair protein MutL OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=mutL PE=3 SV=1 693 888 1.0E-08
sp|A4VQP2|MUTL_PSEU5 DNA mismatch repair protein MutL OS=Pseudomonas stutzeri (strain A1501) GN=mutL PE=3 SV=1 718 881 1.0E-08
sp|B9DPC0|MUTL_STACT DNA mismatch repair protein MutL OS=Staphylococcus carnosus (strain TM300) GN=mutL PE=3 SV=1 683 878 2.0E-08
sp|A7GR98|MUTL_BACCN DNA mismatch repair protein MutL OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutL PE=3 SV=1 718 880 2.0E-08
sp|Q895H3|MUTL_CLOTE DNA mismatch repair protein MutL OS=Clostridium tetani (strain Massachusetts / E88) GN=mutL PE=3 SV=1 683 885 2.0E-08
sp|A6X3F3|MUTL_OCHA4 DNA mismatch repair protein MutL OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutL PE=3 SV=1 716 881 2.0E-08
sp|A0B977|MUTL_METTP DNA mismatch repair protein MutL OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutL PE=3 SV=1 716 878 3.0E-08
sp|A1BCW2|MUTL_CHLPD DNA mismatch repair protein MutL OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mutL PE=3 SV=1 718 881 3.0E-08
sp|B3PRD9|MUTL_RHIE6 DNA mismatch repair protein MutL OS=Rhizobium etli (strain CIAT 652) GN=mutL PE=3 SV=1 687 881 3.0E-08
sp|Q2VYV5|MUTL_MAGSA DNA mismatch repair protein MutL OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutL PE=3 SV=1 716 877 3.0E-08
sp|C0QSY6|MUTL_PERMH DNA mismatch repair protein MutL OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mutL PE=3 SV=1 717 877 4.0E-08
sp|B2GB18|MUTL_LACF3 DNA mismatch repair protein MutL OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutL PE=3 SV=1 714 882 5.0E-08
sp|Q3B1F8|MUTL_CHLL7 DNA mismatch repair protein MutL OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=mutL PE=3 SV=1 718 878 5.0E-08
sp|B4S3X8|MUTL_PROA2 DNA mismatch repair protein MutL OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=mutL PE=3 SV=1 718 878 6.0E-08
sp|B2G6E6|MUTL_LACRJ DNA mismatch repair protein MutL OS=Lactobacillus reuteri (strain JCM 1112) GN=mutL PE=3 SV=1 680 881 6.0E-08
sp|A5VIX0|MUTL_LACRD DNA mismatch repair protein MutL OS=Lactobacillus reuteri (strain DSM 20016) GN=mutL PE=3 SV=1 680 881 6.0E-08
sp|Q1I447|MUTL_PSEE4 DNA mismatch repair protein MutL OS=Pseudomonas entomophila (strain L48) GN=mutL PE=3 SV=1 718 877 7.0E-08
sp|A0AIK6|MUTL_LISW6 DNA mismatch repair protein MutL OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutL PE=3 SV=1 718 878 8.0E-08
sp|C1DLQ0|MUTL_AZOVD DNA mismatch repair protein MutL OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutL PE=3 SV=1 718 881 8.0E-08
sp|B0KKZ7|MUTL_PSEPG DNA mismatch repair protein MutL OS=Pseudomonas putida (strain GB-1) GN=mutL PE=3 SV=1 718 877 8.0E-08
sp|Q92RP4|MUTL_RHIME DNA mismatch repair protein MutL OS=Rhizobium meliloti (strain 1021) GN=mutL PE=3 SV=1 716 881 9.0E-08
sp|Q92BV2|MUTL_LISIN DNA mismatch repair protein MutL OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutL PE=3 SV=1 718 878 1.0E-07
sp|Q88DD1|MUTL_PSEPK DNA mismatch repair protein MutL OS=Pseudomonas putida (strain KT2440) GN=mutL PE=3 SV=1 718 877 1.0E-07
sp|B3QW86|MUTL_CHLT3 DNA mismatch repair protein MutL OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=mutL PE=3 SV=1 718 881 1.0E-07
sp|Q1MKU7|MUTL_RHIL3 DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutL PE=3 SV=1 716 881 1.0E-07
sp|A6U6K5|MUTL_SINMW DNA mismatch repair protein MutL OS=Sinorhizobium medicae (strain WSM419) GN=mutL PE=3 SV=1 716 881 1.0E-07
sp|Q2RQ52|MUTL_RHORT DNA mismatch repair protein MutL OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutL PE=3 SV=1 689 881 1.0E-07
sp|Q65JE1|MUTL_BACLD DNA mismatch repair protein MutL OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutL PE=3 SV=1 718 880 2.0E-07
sp|Q49X89|MUTL_STAS1 DNA mismatch repair protein MutL OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutL PE=3 SV=1 683 878 2.0E-07
sp|Q9HUL8|MUTL_PSEAE DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutL PE=3 SV=1 718 881 2.0E-07
sp|B7V209|MUTL_PSEA8 DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain LESB58) GN=mutL PE=3 SV=1 718 881 2.0E-07
sp|Q02F72|MUTL_PSEAB DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutL PE=3 SV=1 718 881 2.0E-07
sp|Q1RGP6|MUTL_RICBR DNA mismatch repair protein MutL OS=Rickettsia bellii (strain RML369-C) GN=mutL PE=3 SV=1 688 881 2.0E-07
sp|A8GY89|MUTL_RICB8 DNA mismatch repair protein MutL OS=Rickettsia bellii (strain OSU 85-389) GN=mutL PE=3 SV=1 688 881 2.0E-07
sp|Q8UHI3|MUTL_AGRFC DNA mismatch repair protein MutL OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutL PE=3 SV=2 718 881 2.0E-07
sp|A8GQA9|MUTL_RICAH DNA mismatch repair protein MutL OS=Rickettsia akari (strain Hartford) GN=mutL PE=3 SV=1 688 881 2.0E-07
sp|Q2GJE2|MUTL_ANAPZ DNA mismatch repair protein MutL OS=Anaplasma phagocytophilum (strain HZ) GN=mutL PE=3 SV=1 714 881 2.0E-07
sp|B8E280|MUTL_DICTD DNA mismatch repair protein MutL OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=mutL PE=3 SV=1 683 883 2.0E-07
sp|B1JAD6|MUTL_PSEPW DNA mismatch repair protein MutL OS=Pseudomonas putida (strain W619) GN=mutL PE=3 SV=1 718 877 2.0E-07
sp|B5ZS00|MUTL_RHILW DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=mutL PE=3 SV=1 716 881 2.0E-07
sp|Q6G0J4|MUTL_BARQU DNA mismatch repair protein MutL OS=Bartonella quintana (strain Toulouse) GN=mutL PE=3 SV=1 696 881 2.0E-07
sp|A0LJK2|MUTL_SYNFM DNA mismatch repair protein MutL OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutL PE=3 SV=1 716 877 2.0E-07
sp|Q8Y788|MUTL_LISMO DNA mismatch repair protein MutL OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutL PE=3 SV=1 676 878 3.0E-07
sp|C1L2W0|MUTL_LISMC DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutL PE=3 SV=1 718 878 3.0E-07
sp|B8DFS3|MUTL_LISMH DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutL PE=3 SV=1 718 878 3.0E-07
sp|Q9RTR0|MUTL_DEIRA DNA mismatch repair protein MutL OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mutL PE=3 SV=1 676 881 3.0E-07
sp|A6VD59|MUTL_PSEA7 DNA mismatch repair protein MutL OS=Pseudomonas aeruginosa (strain PA7) GN=mutL PE=3 SV=1 718 881 3.0E-07
sp|Q3A504|MUTL_PELCD DNA mismatch repair protein MutL OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutL PE=3 SV=1 678 878 3.0E-07
sp|Q2GFV4|MUTL_EHRCR DNA mismatch repair protein MutL OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mutL PE=3 SV=1 705 881 3.0E-07
sp|B8ETE4|MUTL_METSB DNA mismatch repair protein MutL OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=mutL PE=3 SV=1 696 881 3.0E-07
sp|Q9KAC1|MUTL_BACHD DNA mismatch repair protein MutL OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutL PE=3 SV=1 718 882 4.0E-07
sp|Q71ZR6|MUTL_LISMF DNA mismatch repair protein MutL OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutL PE=3 SV=1 718 878 4.0E-07
sp|C1CBX8|MUTL_STRZJ DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain JJA) GN=mutL PE=3 SV=1 716 883 4.0E-07
sp|C0RKF6|MUTL_BRUMB DNA mismatch repair protein MutL OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=mutL PE=3 SV=1 696 881 4.0E-07
sp|A1UU01|MUTL_BARBK DNA mismatch repair protein MutL OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutL PE=3 SV=1 696 881 4.0E-07
sp|Q88UZ8|MUTL_LACPL DNA mismatch repair protein MutL OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutL PE=3 SV=1 680 882 4.0E-07
sp|B2II71|MUTL_BEII9 DNA mismatch repair protein MutL OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=mutL PE=3 SV=1 691 881 4.0E-07
sp|A9MDX3|MUTL_BRUC2 DNA mismatch repair protein MutL OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|P65490|MUTL_BRUSU DNA mismatch repair protein MutL OS=Brucella suis biovar 1 (strain 1330) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|A5VTW1|MUTL_BRUO2 DNA mismatch repair protein MutL OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|P65489|MUTL_BRUME DNA mismatch repair protein MutL OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|Q579M7|MUTL_BRUAB DNA mismatch repair protein MutL OS=Brucella abortus biovar 1 (strain 9-941) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|Q2YIH2|MUTL_BRUA2 DNA mismatch repair protein MutL OS=Brucella abortus (strain 2308) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|B2SD15|MUTL_BRUA1 DNA mismatch repair protein MutL OS=Brucella abortus (strain S19) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|A9WXS2|MUTL_BRUSI DNA mismatch repair protein MutL OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutL PE=3 SV=1 716 881 5.0E-07
sp|Q4UJQ1|MUTL_RICFE DNA mismatch repair protein MutL OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutL PE=3 SV=1 688 881 5.0E-07
sp|A9IN82|MUTL_BART1 DNA mismatch repair protein MutL OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutL PE=3 SV=1 696 881 5.0E-07
sp|A8F0A4|MUTL_RICCK DNA mismatch repair protein MutL OS=Rickettsia canadensis (strain McKiel) GN=mutL PE=3 SV=1 682 881 6.0E-07
sp|A9BJB9|MUTL_PETMO DNA mismatch repair protein MutL OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mutL PE=3 SV=1 680 878 6.0E-07
sp|A5FW68|MUTL_ACICJ DNA mismatch repair protein MutL OS=Acidiphilium cryptum (strain JF-5) GN=mutL PE=3 SV=1 701 883 6.0E-07
sp|B5E6C5|MUTL_STRP4 DNA mismatch repair protein MutL OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=mutL PE=3 SV=1 716 883 7.0E-07
sp|B2IS10|MUTL_STRPS DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain CGSP14) GN=mutL PE=3 SV=1 716 883 7.0E-07
sp|B8ZKC9|MUTL_STRPJ DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mutL PE=3 SV=1 716 883 7.0E-07
sp|Q04MR4|MUTL_STRP2 DNA mismatch repair protein MutL OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mutL PE=3 SV=1 716 883 7.0E-07
sp|P0A3R2|HEXB_STRR6 DNA mismatch repair protein HexB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hexB PE=3 SV=1 716 883 7.0E-07
sp|P0A3R1|HEXB_STRPN DNA mismatch repair protein HexB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hexB PE=3 SV=1 716 883 7.0E-07
sp|C1CP43|MUTL_STRZT DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mutL PE=3 SV=1 716 883 7.0E-07
sp|C1CI68|MUTL_STRZP DNA mismatch repair protein MutL OS=Streptococcus pneumoniae (strain P1031) GN=mutL PE=3 SV=1 716 883 7.0E-07
sp|B0K1A3|MUTL_THEPX DNA mismatch repair protein MutL OS=Thermoanaerobacter sp. (strain X514) GN=mutL PE=3 SV=1 637 878 8.0E-07
sp|Q6G4R4|MUTL_BARHE DNA mismatch repair protein MutL OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mutL PE=3 SV=1 696 881 8.0E-07
sp|Q03EQ8|MUTL_PEDPA DNA mismatch repair protein MutL OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mutL PE=3 SV=1 714 881 1.0E-06
sp|Q8RA70|MUTL_CALS4 DNA mismatch repair protein MutL OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutL PE=3 SV=1 716 878 1.0E-06
sp|B3PDC3|MUTL_CELJU DNA mismatch repair protein MutL OS=Cellvibrio japonicus (strain Ueda107) GN=mutL PE=3 SV=1 718 877 1.0E-06
sp|A5V3J3|MUTL_SPHWW DNA mismatch repair protein MutL OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutL PE=3 SV=1 714 877 1.0E-06
sp|Q92FW6|MUTL_RICCN DNA mismatch repair protein MutL OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutL PE=3 SV=1 688 881 1.0E-06
sp|Q1GSN3|MUTL_SPHAL DNA mismatch repair protein MutL OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mutL PE=3 SV=1 714 882 1.0E-06
sp|C4K2Y5|MUTL_RICPU DNA mismatch repair protein MutL OS=Rickettsia peacockii (strain Rustic) GN=mutL PE=3 SV=1 688 881 1.0E-06
sp|C3PM22|MUTL_RICAE DNA mismatch repair protein MutL OS=Rickettsia africae (strain ESF-5) GN=mutL PE=3 SV=1 688 881 1.0E-06
sp|B7GIA3|MUTL_ANOFW DNA mismatch repair protein MutL OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=mutL PE=3 SV=1 656 881 2.0E-06
sp|Q3BSD0|MUTL_XANC5 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutL PE=3 SV=1 718 877 2.0E-06
sp|B0K9L6|MUTL_THEP3 DNA mismatch repair protein MutL OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mutL PE=3 SV=1 637 878 2.0E-06
sp|B5YE42|MUTL_DICT6 DNA mismatch repair protein MutL OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=mutL PE=3 SV=1 683 883 2.0E-06
sp|Q1QY28|MUTL_CHRSD DNA mismatch repair protein MutL OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutL PE=3 SV=1 718 877 2.0E-06
sp|B9EBI5|MUTL_MACCJ DNA mismatch repair protein MutL OS=Macrococcus caseolyticus (strain JCSC5402) GN=mutL PE=3 SV=1 683 878 3.0E-06
sp|Q1WT16|MUTL_LACS1 DNA mismatch repair protein MutL OS=Lactobacillus salivarius (strain UCC118) GN=mutL PE=3 SV=1 680 881 3.0E-06
sp|Q8PJX2|MUTL_XANAC DNA mismatch repair protein MutL OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutL PE=3 SV=1 718 877 3.0E-06
sp|Q03R34|MUTL_LACBA DNA mismatch repair protein MutL OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutL PE=3 SV=1 680 882 3.0E-06
sp|C3KDW1|MUTL_PSEFS DNA mismatch repair protein MutL OS=Pseudomonas fluorescens (strain SBW25) GN=mutL PE=3 SV=1 718 877 3.0E-06
sp|Q87VJ2|MUTL_PSESM DNA mismatch repair protein MutL OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutL PE=3 SV=1 718 877 3.0E-06
sp|Q3SIQ5|MUTL_THIDA DNA mismatch repair protein MutL OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutL PE=3 SV=1 718 881 3.0E-06
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 712 885 3.0E-06
sp|B1N024|MUTL_LEUCK DNA mismatch repair protein MutL OS=Leuconostoc citreum (strain KM20) GN=mutL PE=3 SV=1 716 882 4.0E-06
sp|Q7WG61|MUTL_BORBR DNA mismatch repair protein MutL OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutL PE=3 SV=1 718 877 4.0E-06
sp|Q7W0A6|MUTL_BORPE DNA mismatch repair protein MutL OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutL PE=3 SV=1 718 877 4.0E-06
sp|Q7W4N5|MUTL_BORPA DNA mismatch repair protein MutL OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutL PE=3 SV=1 718 877 4.0E-06
sp|Q8P8E4|MUTL_XANCP DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutL PE=3 SV=1 718 892 6.0E-06
sp|B0RRZ8|MUTL_XANCB DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain B100) GN=mutL PE=3 SV=1 718 892 6.0E-06
sp|Q4UVP3|MUTL_XANC8 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutL PE=3 SV=1 718 892 6.0E-06
sp|Q2GDF7|MUTL_NEOSM DNA mismatch repair protein MutL OS=Neorickettsia sennetsu (strain Miyayama) GN=mutL PE=3 SV=1 716 883 7.0E-06
sp|P49850|MUTL_BACSU DNA mismatch repair protein MutL OS=Bacillus subtilis (strain 168) GN=mutL PE=1 SV=1 718 880 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006298 mismatch repair Yes
GO:0030983 mismatched DNA binding Yes
GO:0005524 ATP binding Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0003677 DNA binding No
GO:0051716 cellular response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0033554 cellular response to stress No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0006281 DNA repair No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0036094 small molecule binding No
GO:0003690 double-stranded DNA binding No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0030554 adenyl nucleotide binding No
GO:0003676 nucleic acid binding No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0050896 response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4955
MATIKAIDSHTIHQIQSGQVIVDLCSVVKELVENSIDAGATSIDVRVKNQGLDLIEVQDNGSGIAAANHASLALK
HHTSKLSTYSDIASLRTFGFRGEALASLCALADLTITTCLEADAPRASRLSFDPSGQLIDSTFVAAGRGTTVSVQ
RLFHNLPVRRRELERNVKREWHKAVALLNQYACIQTHLKFSVYQQPSKGKRILLFSTKGNADTRDNIINIFGTRV
TSNLVPLDLKLELQPSNVSFGSSLETSSAHVVRITGHVSRPAPGNGRQTPDRQMFYVNGRPCSLPQFARIFNDVY
RSYNCSQSPFIFADIQLDTSLYDVNVSPDKRTILIHDQGHLLDTLRAALSELFDTQDQIIPASRIPDSVQEAPFH
KKLPDPRSSAQKFSKAKENSRSSSPALTSDGDREEDSDSSSNSPHPIKSPVYTRSRNTQAVGIRRWLSPHSVPSN
SSSLHAGGQHHLTSRDSADTSRCKVKSSTRRHMASLTDSRELIRGPSEESDATSEDTAHAAVEKTHRSDSTCAES
PPIDTDHQPRAEPALPPYLAQDQPTLDKMDLVGDEAHGNARSPSDGESNGKAQSVERVKSASCDMDTETSREPAV
PRPIHGDSPSPTFISIPRQSPLQVMTTLRTDEKDVSFLMDNYLKHCSMADSGSSTDIGIQDIESADAEKKLTLII
SKGDFDKMRIVGQFNMGFVIAVRPAVLDTHPASQSQIPAFDELFIIDQHASDEKYNFEKLQVTNALQSQHLVNPK
ILNLTPLEEEVVRENIQAIEANGFKVDIDTSGNAPVGSRCHITALPLSHETTFGLEDFRELVALLEDECADSHHI
PRPSKVRKMFASRACRSSIMIGKALTLSQMRALVRQMSELDKPWNCPHGRPTMRHLCRLKTWGDKRWDMDVSASP
LSMWKAYANGK*
Coding >OphauB2|4955
ATGGCTACCATAAAGGCCATTGACAGCCACACGATACACCAAATCCAATCAGGGCAGGTCATTGTTGACCTGTGC
TCCGTTGTCAAAGAACTCGTTGAAAACAGCATCGATGCGGGAGCTACAAGTATAGATGTCCGAGTCAAGAACCAA
GGTCTGGACCTCATCGAGGTGCAAGACAATGGCTCTGGTATCGCTGCCGCCAATCACGCCTCGCTCGCCCTCAAA
CACCACACCTCCAAGCTCTCAACATATTCCGACATTGCCTCCCTTCGAACCTTTGGCTTTCGAGGCGAAGCATTG
GCCTCGCTATGTGCCCTAGCCGACCTAACAATCACCACCTGTCTCGAAGCCGACGCACCTCGCGCTTCGCGCCTT
AGCTTTGATCCAAGCGGCCAGCTCATTGACTCCACGTTTGTTGCTGCTGGAAGGGGCACAACAGTGTCAGTGCAG
CGTCTCTTCCATAACCTTCCCGTTCGTCGCCGCGAACTCGAGCGCAATGTTAAACGAGAGTGGCACAAGGCTGTT
GCGCTTCTCAACCAGTACGCATGTATTCAGACACACCTCAAGTTCTCCGTCTATCAACAGCCGTCCAAGGGCAAG
CGCATTCTTCTCTTCTCAACCAAGGGAAACGCTGATACCCGAGATAACATTATCAATATATTTGGCACTCGTGTC
ACGTCGAACCTTGTTCCTCTCGACTTGAAGCTTGAGCTGCAGCCTTCGAACGTGTCATTTGGTTCCTCATTAGAG
ACCTCATCTGCTCATGTGGTGCGCATCACCGGACATGTATCGCGTCCTGCGCCCGGAAATGGCCGCCAAACACCA
GATAGACAAATGTTTTATGTCAACGGAAGGCCATGTTCTCTCCCCCAATTCGCGCGCATCTTTAACGATGTCTAT
CGCTCTTACAACTGTTCCCAGTCGCCCTTCATCTTTGCCGACATTCAGCTAGATACTTCCTTGTACGACGTCAAT
GTCAGCCCTGACAAGCGCACCATCCTCATACATGATCAAGGTCATCTCCTCGACACATTACGTGCCGCTTTGAGC
GAACTATTTGACACCCAGGATCAGATAATTCCGGCCTCTCGAATACCTGACAGCGTCCAAGAAGCTCCGTTCCAT
AAAAAACTGCCAGATCCAAGAAGCTCGGCTCAAAAATTCTCAAAGGCAAAGGAAAATAGCAGATCCTCTAGCCCT
GCGCTCACTTCGGATGGTGACAGAGAAGAGGATTCTGACTCGAGCAGCAACTCACCGCATCCAATCAAATCCCCA
GTGTACACTAGATCGCGAAACACACAAGCTGTAGGAATTCGCCGATGGTTAAGCCCTCATTCGGTGCCGTCCAAT
TCGTCATCCTTACATGCGGGCGGGCAGCATCATCTTACCTCCCGTGATTCCGCTGATACATCTCGGTGTAAAGTC
AAAAGTTCGACGCGAAGACACATGGCATCATTGACAGACTCACGTGAACTAATTCGAGGGCCGTCGGAGGAAAGT
GATGCTACATCTGAGGACACCGCCCATGCTGCTGTCGAGAAAACACATCGCTCCGACTCAACTTGTGCTGAGTCT
CCACCTATAGACACAGATCATCAACCTCGAGCTGAACCAGCTCTTCCACCGTATCTTGCTCAAGACCAGCCAACT
CTGGACAAGATGGATCTTGTGGGAGACGAGGCTCATGGGAACGCACGGAGCCCTAGCGATGGGGAAAGTAATGGG
AAAGCTCAGTCTGTTGAAAGAGTCAAGTCAGCAAGCTGTGACATGGATACAGAGACGAGTCGAGAACCAGCAGTG
CCGCGTCCCATTCATGGAGATTCGCCCTCTCCGACATTTATCAGTATCCCGCGGCAATCGCCACTCCAAGTCATG
ACCACGCTGCGAACCGATGAGAAAGATGTATCATTTTTAATGGACAATTATCTCAAACACTGTAGCATGGCGGAC
TCTGGATCTTCTACCGACATTGGCATACAAGATATTGAATCCGCTGATGCTGAAAAGAAGCTTACACTCATCATT
TCCAAGGGTGACTTTGATAAGATGCGCATCGTTGGTCAATTCAACATGGGTTTCGTCATAGCTGTGCGACCGGCT
GTACTTGACACACATCCGGCTTCTCAGTCCCAAATACCGGCGTTTGACGAACTTTTTATAATTGACCAGCATGCT
TCGGACGAGAAGTACAATTTCGAGAAGCTGCAAGTTACGAATGCACTCCAGTCTCAACATCTGGTGAATCCAAAA
ATCCTCAACTTGACTCCTTTGGAAGAAGAAGTTGTCAGGGAGAACATCCAAGCCATTGAAGCCAACGGCTTCAAG
GTGGACATTGACACGTCGGGCAACGCGCCAGTCGGTTCTCGGTGCCATATCACAGCGCTGCCTCTTAGCCATGAG
ACGACTTTTGGTTTAGAGGATTTTCGGGAGTTGGTTGCGCTTCTTGAAGACGAATGTGCCGATTCACATCATATA
CCAAGGCCTTCCAAGGTGAGAAAAATGTTTGCATCTAGGGCGTGTCGAAGCAGCATCATGATTGGCAAGGCCTTG
ACTTTGAGCCAGATGCGAGCATTGGTGAGACAAATGAGCGAACTGGACAAGCCGTGGAATTGCCCACACGGCCGC
CCAACCATGAGACATCTTTGTAGACTTAAAACTTGGGGCGATAAGCGCTGGGATATGGACGTATCAGCCTCTCCC
TTGTCGATGTGGAAGGCATATGCAAACGGCAAGTAG
Transcript >OphauB2|4955
ATGGCTACCATAAAGGCCATTGACAGCCACACGATACACCAAATCCAATCAGGGCAGGTCATTGTTGACCTGTGC
TCCGTTGTCAAAGAACTCGTTGAAAACAGCATCGATGCGGGAGCTACAAGTATAGATGTCCGAGTCAAGAACCAA
GGTCTGGACCTCATCGAGGTGCAAGACAATGGCTCTGGTATCGCTGCCGCCAATCACGCCTCGCTCGCCCTCAAA
CACCACACCTCCAAGCTCTCAACATATTCCGACATTGCCTCCCTTCGAACCTTTGGCTTTCGAGGCGAAGCATTG
GCCTCGCTATGTGCCCTAGCCGACCTAACAATCACCACCTGTCTCGAAGCCGACGCACCTCGCGCTTCGCGCCTT
AGCTTTGATCCAAGCGGCCAGCTCATTGACTCCACGTTTGTTGCTGCTGGAAGGGGCACAACAGTGTCAGTGCAG
CGTCTCTTCCATAACCTTCCCGTTCGTCGCCGCGAACTCGAGCGCAATGTTAAACGAGAGTGGCACAAGGCTGTT
GCGCTTCTCAACCAGTACGCATGTATTCAGACACACCTCAAGTTCTCCGTCTATCAACAGCCGTCCAAGGGCAAG
CGCATTCTTCTCTTCTCAACCAAGGGAAACGCTGATACCCGAGATAACATTATCAATATATTTGGCACTCGTGTC
ACGTCGAACCTTGTTCCTCTCGACTTGAAGCTTGAGCTGCAGCCTTCGAACGTGTCATTTGGTTCCTCATTAGAG
ACCTCATCTGCTCATGTGGTGCGCATCACCGGACATGTATCGCGTCCTGCGCCCGGAAATGGCCGCCAAACACCA
GATAGACAAATGTTTTATGTCAACGGAAGGCCATGTTCTCTCCCCCAATTCGCGCGCATCTTTAACGATGTCTAT
CGCTCTTACAACTGTTCCCAGTCGCCCTTCATCTTTGCCGACATTCAGCTAGATACTTCCTTGTACGACGTCAAT
GTCAGCCCTGACAAGCGCACCATCCTCATACATGATCAAGGTCATCTCCTCGACACATTACGTGCCGCTTTGAGC
GAACTATTTGACACCCAGGATCAGATAATTCCGGCCTCTCGAATACCTGACAGCGTCCAAGAAGCTCCGTTCCAT
AAAAAACTGCCAGATCCAAGAAGCTCGGCTCAAAAATTCTCAAAGGCAAAGGAAAATAGCAGATCCTCTAGCCCT
GCGCTCACTTCGGATGGTGACAGAGAAGAGGATTCTGACTCGAGCAGCAACTCACCGCATCCAATCAAATCCCCA
GTGTACACTAGATCGCGAAACACACAAGCTGTAGGAATTCGCCGATGGTTAAGCCCTCATTCGGTGCCGTCCAAT
TCGTCATCCTTACATGCGGGCGGGCAGCATCATCTTACCTCCCGTGATTCCGCTGATACATCTCGGTGTAAAGTC
AAAAGTTCGACGCGAAGACACATGGCATCATTGACAGACTCACGTGAACTAATTCGAGGGCCGTCGGAGGAAAGT
GATGCTACATCTGAGGACACCGCCCATGCTGCTGTCGAGAAAACACATCGCTCCGACTCAACTTGTGCTGAGTCT
CCACCTATAGACACAGATCATCAACCTCGAGCTGAACCAGCTCTTCCACCGTATCTTGCTCAAGACCAGCCAACT
CTGGACAAGATGGATCTTGTGGGAGACGAGGCTCATGGGAACGCACGGAGCCCTAGCGATGGGGAAAGTAATGGG
AAAGCTCAGTCTGTTGAAAGAGTCAAGTCAGCAAGCTGTGACATGGATACAGAGACGAGTCGAGAACCAGCAGTG
CCGCGTCCCATTCATGGAGATTCGCCCTCTCCGACATTTATCAGTATCCCGCGGCAATCGCCACTCCAAGTCATG
ACCACGCTGCGAACCGATGAGAAAGATGTATCATTTTTAATGGACAATTATCTCAAACACTGTAGCATGGCGGAC
TCTGGATCTTCTACCGACATTGGCATACAAGATATTGAATCCGCTGATGCTGAAAAGAAGCTTACACTCATCATT
TCCAAGGGTGACTTTGATAAGATGCGCATCGTTGGTCAATTCAACATGGGTTTCGTCATAGCTGTGCGACCGGCT
GTACTTGACACACATCCGGCTTCTCAGTCCCAAATACCGGCGTTTGACGAACTTTTTATAATTGACCAGCATGCT
TCGGACGAGAAGTACAATTTCGAGAAGCTGCAAGTTACGAATGCACTCCAGTCTCAACATCTGGTGAATCCAAAA
ATCCTCAACTTGACTCCTTTGGAAGAAGAAGTTGTCAGGGAGAACATCCAAGCCATTGAAGCCAACGGCTTCAAG
GTGGACATTGACACGTCGGGCAACGCGCCAGTCGGTTCTCGGTGCCATATCACAGCGCTGCCTCTTAGCCATGAG
ACGACTTTTGGTTTAGAGGATTTTCGGGAGTTGGTTGCGCTTCTTGAAGACGAATGTGCCGATTCACATCATATA
CCAAGGCCTTCCAAGGTGAGAAAAATGTTTGCATCTAGGGCGTGTCGAAGCAGCATCATGATTGGCAAGGCCTTG
ACTTTGAGCCAGATGCGAGCATTGGTGAGACAAATGAGCGAACTGGACAAGCCGTGGAATTGCCCACACGGCCGC
CCAACCATGAGACATCTTTGTAGACTTAAAACTTGGGGCGATAAGCGCTGGGATATGGACGTATCAGCCTCTCCC
TTGTCGATGTGGAAGGCATATGCAAACGGCAAGTAG
Gene >OphauB2|4955
ATGGCTACCATAAAGGCCATTGACAGCCACACGGCATGTCGCCTCGTTTTACCTACTTGACCGCACTTGGACGAC
TGTATACTAATGATTAATGTGTATAGATACACCAAATCCAATCAGGGCAGGTCATTGTTGACCTGTGCTCCGTTG
TCAAAGAACTCGTTGAAAACAGCATCGATGCGGGAGCTACAAGTATAGGTGCGTCGCATGTCTTTGACCATGATT
GTTGCTAGTCAACTGATCAAACAAGATGTCCGAGTCAAGAACCAAGGTCTGGACCTCATCGAGGTGCAAGACAAT
GGCTCTGGTATCGCTGCCGCCAATCACGCCTCGCTCGCCCTCAAACACCACACCTCCAAGCTCTCAACATATTCC
GACATTGCCTCCCTTCGAACCTTTGGCTTTCGAGGCGAAGCATTGGCCTCGCTATGTGCCCTAGCCGACCTAACA
ATCACCACCTGTCTCGAAGCCGACGCACCTCGCGCTTCGCGCCTTAGCTTTGATCCAAGCGGCCAGCTCATTGAC
TCCACGTTTGTTGCTGCTGGAAGGGGCACAACAGTGTCAGTGCAGCGTCTCTTCCATAACCTTCCCGTTCGTCGC
CGCGAACTCGAGCGCAATGTTAAACGAGAGTGGCACAAGGCTGTTGCGCTTCTCAACCAGTACGCATGTATTCAG
ACACACCTCAAGTTCTCCGTCTATCAACAGCCGTCCAAGGGCAAGCGCATTCTTCTCTTCTCAACCAAGGGAAAC
GCTGATACCCGAGATAACATTATCAATATATTTGGCACTCGTGTCACGTCGAACCTTGTTCCTCTCGACTTGAAG
CTTGAGCTGCAGCCTTCGAACGTGTCATTTGGTTCCTCATTAGAGACCTCATCTGCTCATGTGGTGCGCATCACC
GGACATGTATCGCGTCCTGCGCCCGGAAATGGCCGCCAAACACCAGATAGACAAATGTTTTATGTCAACGGAAGG
CCATGTTCTCTCCCCCAATTCGCGCGCATCTTTAACGATGTCTATCGCTCTTACAACTGTTCCCAGTCGCCCTTC
ATCTTTGCCGACATTCAGCTAGATACTTCCTTGTACGACGTCAATGTCAGCCCTGACAAGCGCACCATCCTCATA
CATGATCAAGGTCATCTCCTCGACACATTACGTGCCGCTTTGAGCGAACTATTTGACACCCAGGATCAGATAATT
CCGGCCTCTCGAATACCTGACAGCGTCCAAGAAGCTCCGTTCCATAAAAAACTGCCAGATCCAAGAAGCTCGGCT
CAAAAATTCTCAAAGGCAAAGGAAAATAGCAGATCCTCTAGCCCTGCGCTCACTTCGGATGGTGACAGAGAAGAG
GATTCTGACTCGAGCAGCAACTCACCGCATCCAATCAAATCCCCAGTGTACACTAGATCGCGAAACACACAAGCT
GTAGGAATTCGCCGATGGTTAAGCCCTCATTCGGTGCCGTCCAATTCGTCATCCTTACATGCGGGCGGGCAGCAT
CATCTTACCTCCCGTGATTCCGCTGATACATCTCGGTGTAAAGTCAAAAGTTCGACGCGAAGACACATGGCATCA
TTGACAGACTCACGTGAACTAATTCGAGGGCCGTCGGAGGAAAGTGATGCTACATCTGAGGACACCGCCCATGCT
GCTGTCGAGAAAACACATCGCTCCGACTCAACTTGTGCTGAGTCTCCACCTATAGACACAGATCATCAACCTCGA
GCTGAACCAGCTCTTCCACCGTATCTTGCTCAAGACCAGCCAACTCTGGACAAGATGGATCTTGTGGGAGACGAG
GCTCATGGGAACGCACGGAGCCCTAGCGATGGGGAAAGTAATGGGAAAGCTCAGTCTGTTGAAAGAGTCAAGTCA
GCAAGCTGTGACATGGATACAGAGACGAGTCGAGAACCAGCAGTGCCGCGTCCCATTCATGGAGATTCGCCCTCT
CCGACATTTATCAGTATCCCGCGGCAATCGCCACTCCAAGTCATGACCACGCTGCGAACCGATGAGAAAGATGTA
TCATTTTTAATGGACAATTATCTCAAACACTGTAGCATGGCGGACTCTGGATCTTCTACCGACATTGGCATACAA
GATATTGAATCCGCTGATGCTGAAAAGAAGCTTACACTCATCATTTCCAAGGGTGACTTTGATAAGATGCGCATC
GTTGGTCAATTCAACATGGGTTTCGTCATAGCTGTGCGACCGGCTGTACTTGACACACATCCGGCTTCTCAGTCC
CAAATACCGGCGTTTGACGAACTTTTTATAATTGACCAGCATGCTTCGGACGAGAAGTACAATTTCGAGAAGCTG
CAAGTTACGAATGCACTCCAGTCTCAACATCTGGTGAATCCAAAAATCCTCAACTTGACTCCTTTGGAAGAAGAA
GTTGTCAGGGAGAACATCCAAGCCATTGAAGCCAACGGCTTCAAGGTGGACATTGACACGTCGGGCAACGCGCCA
GTCGGTTCTCGGTGCCATATCACAGCGCTGCCTCTTAGCCATGAGACGACTTTTGGTTTAGAGGATTTTCGGGAG
TTGGTTGCGCTTCTTGAAGACGAATGTGCCGATTCACATCATATACCAAGGCCTTCCAAGGTGAGAAAAATGTTT
GCATCTAGGGCGTGTCGAAGCAGCATCATGATTGGCAAGGCCTTGACTTTGAGCCAGATGCGAGCATTGGTGAGA
CAAATGAGCGAACTGGACAAGCCGTGGAATTGCCCACACGGCCGCCCAACCATGAGACATCTTTGTAGACTTAAA
ACTTGGGGCGATAAGCGCTGGGATATGGACGTATCAGCCTCTCCCTTGTCGATGTGGAAGGCATATGCAAACGGC
AAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail