Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4949
Gene name
LocationContig_35:135976..136531
Strand-
Gene length (bp)555
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 2.6E-16 21 87

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AXU8|CFMC_ARTBC GPI-anchored CFEM domain protein ARB_01017 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01017 PE=3 SV=1 19 99 4.0E-14
sp|Q4WNE1|CFMC_ASPFU GPI anchored CFEM domain protein C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cfmC PE=3 SV=1 1 110 2.0E-12
sp|D4AZC5|CFMA_ARTBC GPI-anchored CFEM domain protein ARB_01545 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01545 PE=1 SV=2 1 86 8.0E-07
sp|G1UB63|CSA1_CANAL Cell wall protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CSA1 PE=1 SV=1 16 131 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4949
MKTAAWIVALATGLAMAQQGLDQLPECAKTCVIKYMSGDELKGCSLGDIKCICTNKDLLSGMSCCLSDACGGEDQ
RKAIEAAKHVCGSANVEVPDEIVCNAGASSSAGAAPATSSSSAASSSSTAASTATAPAASSTGGSASVKVSSGVA
GAIFALLAAL*
Coding >OphauB2|4949
ATGAAGACTGCCGCGTGGATAGTGGCTCTGGCCACGGGACTGGCCATGGCCCAACAGGGCCTGGATCAGCTGCCC
GAGTGCGCGAAAACATGCGTCATCAAGTACATGTCTGGAGACGAGCTCAAGGGCTGCAGCCTGGGCGACATCAAG
TGCATCTGCACCAACAAGGACCTGCTGTCGGGCATGTCGTGCTGCCTCTCTGATGCCTGCGGCGGAGAGGATCAG
CGCAAGGCGATTGAGGCGGCCAAGCATGTGTGCGGCAGCGCCAATGTTGAGGTGCCGGACGAGATTGTGTGCAAT
GCGGGAGCGTCGTCTTCTGCCGGAGCGGCGCCGGCCACTTCGAGCTCTTCGGCGGCGTCGTCGTCTTCGACTGCG
GCTTCGACTGCTACGGCTCCGGCGGCTTCGTCTACGGGGGGGAGTGCCTCGGTCAAGGTTTCGAGCGGAGTTGCT
GGAGCCATTTTTGCCCTGCTGGCGGCCCTTTGA
Transcript >OphauB2|4949
ATGAAGACTGCCGCGTGGATAGTGGCTCTGGCCACGGGACTGGCCATGGCCCAACAGGGCCTGGATCAGCTGCCC
GAGTGCGCGAAAACATGCGTCATCAAGTACATGTCTGGAGACGAGCTCAAGGGCTGCAGCCTGGGCGACATCAAG
TGCATCTGCACCAACAAGGACCTGCTGTCGGGCATGTCGTGCTGCCTCTCTGATGCCTGCGGCGGAGAGGATCAG
CGCAAGGCGATTGAGGCGGCCAAGCATGTGTGCGGCAGCGCCAATGTTGAGGTGCCGGACGAGATTGTGTGCAAT
GCGGGAGCGTCGTCTTCTGCCGGAGCGGCGCCGGCCACTTCGAGCTCTTCGGCGGCGTCGTCGTCTTCGACTGCG
GCTTCGACTGCTACGGCTCCGGCGGCTTCGTCTACGGGGGGGAGTGCCTCGGTCAAGGTTTCGAGCGGAGTTGCT
GGAGCCATTTTTGCCCTGCTGGCGGCCCTTTGA
Gene >OphauB2|4949
ATGAAGACTGCCGCGTGGATAGTGGCTCTGGCCACGGGACTGGCCATGGCCCAACAGGGCCTGGATCAGCTGCCC
GAGTGCGCGGTGGGTGCAGACCAAGGCACCTCTTCAAGTGCACCAGGCGAGACAGACCAAGCTGACGGTGGGCGT
GGGCAGAAAACATGCGTCATCAAGTACATGTCTGGAGACGAGCTCAAGGGCTGCAGCCTGGGCGACATCAAGTGC
ATCTGCACCAACAAGGACCTGCTGTCGGGCATGTCGTGCTGCCTCTCTGATGCCTGCGGCGGAGAGGATCAGCGC
AAGGCGATTGAGGCGGCCAAGCATGTGTGCGGCAGCGCCAATGTTGAGGTGCCGGACGAGATTGTGTGCAATGCG
GGAGCGTCGTCTTCTGCCGGAGCGGCGCCGGCCACTTCGAGCTCTTCGGCGGCGTCGTCGTCTTCGACTGCGGCT
TCGACTGCTACGGCTCCGGCGGCTTCGTCTACGGGGGGGAGTGCCTCGGTCAAGGTTTCGAGCGGAGTTGCTGGA
GCCATTTTTGCCCTGCTGGCGGCCCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail