Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4944
Gene name
LocationContig_35:127773..129298
Strand+
Gene length (bp)1525
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 1.5E-70 36 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q873X9|CHIB1_ASPFM Endochitinase B1 OS=Neosartorya fumigata GN=chiB1 PE=1 SV=1 34 461 2.0E-124
sp|E9QRF2|CHIB1_ASPFU Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiB1 PE=3 SV=1 34 461 2.0E-124
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 35 461 2.0E-123
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 35 461 9.0E-122
sp|E9ERT9|CHI1_METRA Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chit1 PE=3 SV=1 35 458 7.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q873X9|CHIB1_ASPFM Endochitinase B1 OS=Neosartorya fumigata GN=chiB1 PE=1 SV=1 34 461 2.0E-124
sp|E9QRF2|CHIB1_ASPFU Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiB1 PE=3 SV=1 34 461 2.0E-124
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 35 461 2.0E-123
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 35 461 9.0E-122
sp|E9ERT9|CHI1_METRA Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chit1 PE=3 SV=1 35 458 7.0E-120
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 35 461 7.0E-117
sp|O14456|CHI1_METAN Endochitinase 1 OS=Metarhizium anisopliae GN=chit1 PE=1 SV=1 35 458 2.0E-116
sp|Q1E3R8|CHI1_COCIM Endochitinase 1 OS=Coccidioides immitis (strain RS) GN=CTS1 PE=3 SV=1 34 461 2.0E-116
sp|P0CB51|CHI1_COCPS Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CTS1 PE=1 SV=1 34 461 3.0E-116
sp|C5P230|CHI1_COCP7 Endochitinase 1 OS=Coccidioides posadasii (strain C735) GN=CTS1 PE=3 SV=1 34 461 1.0E-115
sp|Q92222|CHIB_EMEND Endochitinase B OS=Emericella nidulans GN=chiB PE=1 SV=3 38 461 1.0E-112
sp|G5EAZ3|CHIB1_EMENI Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiB PE=1 SV=1 38 461 1.0E-112
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 34 444 3.0E-47
sp|Q06350|CHI2_YEAST Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS2 PE=1 SV=1 37 458 2.0E-43
sp|P20533|CHIA1_BACCI Chitinase A1 OS=Bacillus circulans GN=chiA1 PE=1 SV=1 38 292 9.0E-39
sp|P07254|CHIA_SERMA Chitinase A OS=Serratia marcescens GN=chiA PE=1 SV=3 21 436 3.0E-37
sp|P41684|CHIT_NPVAC Probable endochitinase OS=Autographa californica nuclear polyhedrosis virus PE=3 SV=1 36 421 1.0E-33
sp|O10363|CHIT_NPVOP Probable endochitinase OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=ORF124 PE=3 SV=1 27 437 1.0E-32
sp|P32823|CHIA_PSEO7 Chitinase A OS=Pseudoalteromonas piscicida GN=chiA PE=1 SV=1 38 422 2.0E-31
sp|P11797|CHIB_SERMA Chitinase B OS=Serratia marcescens GN=chiB PE=1 SV=1 47 308 3.0E-31
sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 36 322 2.0E-29
sp|P11220|CHIT_STRPL Chitinase 63 OS=Streptomyces plicatus GN=chtA PE=1 SV=2 38 437 1.0E-28
sp|Q9W092|CHIT2_DROME Probable chitinase 2 OS=Drosophila melanogaster GN=Cht2 PE=1 SV=1 38 421 4.0E-28
sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 36 436 5.0E-27
sp|Q11174|CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans GN=cht-1 PE=1 SV=1 37 303 2.0E-26
sp|Q6RY07|CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus GN=Chia PE=2 SV=1 36 436 3.0E-26
sp|P36909|CHIT_STRLI Chitinase C OS=Streptomyces lividans GN=chiC PE=2 SV=1 38 322 9.0E-26
sp|P36222|CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens GN=CHI3L1 PE=1 SV=2 36 308 2.0E-25
sp|Q9BZP6|CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens GN=CHIA PE=1 SV=1 36 436 3.0E-25
sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 37 436 6.0E-25
sp|Q29411|CH3L1_PIG Chitinase-3-like protein 1 OS=Sus scrofa GN=CHI3L1 PE=1 SV=2 31 322 7.0E-25
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 21 437 1.0E-24
sp|Q9WTV1|CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus GN=Chi3l1 PE=2 SV=3 36 421 2.0E-24
sp|Q5RBP6|CH3L1_PONAB Chitinase-3-like protein 1 OS=Pongo abelii GN=CHI3L1 PE=2 SV=1 36 308 3.0E-24
sp|Q8SPQ0|CH3L1_CAPHI Chitinase-3-like protein 1 OS=Capra hircus GN=CHI3L1 PE=1 SV=1 38 322 3.0E-24
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 36 319 5.0E-24
sp|P30922|CH3L1_BOVIN Chitinase-3-like protein 1 OS=Bos taurus GN=CHI3L1 PE=1 SV=3 38 322 1.0E-23
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 30 443 3.0E-23
sp|Q6TMG6|CH3L1_SHEEP Chitinase-3-like protein 1 OS=Ovis aries GN=CHI3L1 PE=1 SV=1 38 322 3.0E-23
sp|Q7YS85|CH3L1_BUBBU Chitinase-3-like protein 1 OS=Bubalus bubalis GN=CHI3L1 PE=1 SV=3 38 322 6.0E-23
sp|P36362|CHIT_MANSE Endochitinase OS=Manduca sexta PE=2 SV=1 34 299 1.0E-22
sp|H2A0L4|CHI1_PINMG Putative chitinase 1 OS=Pinctada margaritifera PE=1 SV=1 36 421 2.0E-21
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 28 458 3.0E-21
sp|Q61362|CH3L1_MOUSE Chitinase-3-like protein 1 OS=Mus musculus GN=Chi3l1 PE=1 SV=3 38 322 6.0E-21
sp|P29030|CHIT_BRUMA Endochitinase OS=Brugia malayi PE=1 SV=1 37 438 1.0E-20
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 32 308 4.0E-20
sp|Q28042|OVGP1_BOVIN Oviduct-specific glycoprotein (Fragment) OS=Bos taurus GN=OVGP1 PE=1 SV=1 29 322 7.0E-20
sp|Q15782|CH3L2_HUMAN Chitinase-3-like protein 2 OS=Homo sapiens GN=CHI3L2 PE=1 SV=1 36 308 2.0E-19
sp|Q28542|OVGP1_SHEEP Oviduct-specific glycoprotein OS=Ovis aries GN=OVGP1 PE=1 SV=1 29 322 2.0E-19
sp|Q12889|OVGP1_HUMAN Oviduct-specific glycoprotein OS=Homo sapiens GN=OVGP1 PE=2 SV=1 31 322 2.0E-17
sp|Q60557|OVGP1_MESAU Oviduct-specific glycoprotein OS=Mesocricetus auratus GN=OVGP1 PE=1 SV=1 38 294 5.0E-17
sp|O35744|CHIL3_MOUSE Chitinase-like protein 3 OS=Mus musculus GN=Chil3 PE=1 SV=2 38 421 7.0E-17
sp|P36718|OVGP1_PAPAN Oviduct-specific glycoprotein OS=Papio anubis GN=OVGP1 PE=2 SV=2 29 322 5.0E-16
sp|P86955|CHI_PINMA Putative chitinase OS=Pinctada maxima PE=1 SV=1 5 309 6.0E-16
sp|A5FB63|CHIA_FLAJ1 Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=chiA PE=1 SV=1 38 294 2.0E-15
sp|Q28990|OVGP1_PIG Oviduct-specific glycoprotein OS=Sus scrofa GN=OVGP1 PE=2 SV=1 31 322 5.0E-15
sp|Q62010|OVGP1_MOUSE Oviduct-specific glycoprotein OS=Mus musculus GN=Ovgp1 PE=2 SV=1 38 294 1.0E-14
sp|Q91Z98|CHIL4_MOUSE Chitinase-like protein 4 OS=Mus musculus GN=Chil4 PE=1 SV=2 5 421 2.0E-14
sp|H2A0L5|CHI2_PINMG Putative chitinase 2 OS=Pinctada margaritifera PE=1 SV=1 51 309 4.0E-14
sp|P96156|CHID_VIBFU Chitodextrinase OS=Vibrio furnissii GN=endo I PE=1 SV=1 38 292 6.0E-10
sp|Q5AKZ3|CHI5_CANAL Probable chitinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.12451 PE=3 SV=1 118 310 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4944
MLDRLVIAGWMLAGVALGQGVEKQSYRSENATQRNALYFTNWGIYKANFQPEQLPVKDITHVLYAFGDISENGTV
VSTDSYADLEKHYAGDSWAETGHNAYGCVKQLYALKQQNRHLKVLYSIGGFSASEQGHFAYAASTASRRRIFAQS
AVKIVADWGLDGLDIDWEFARNGSEATQLVQLLEACREELDKYAARLGQAYHYELSVASSAGKQHYSKLHLKEMD
AVLDAWHLMAYDYAGPWDATAGHQASLHHDAANPTSTKFCTEQAVEDYLAAGVPAHKLILGLPLYGRSFARAGGP
GSSFAGPGGGSLQDGVWLYRDLPRPGAREYTSDALAVAWSVGSEASTGGGGGGDGGGDGGGVGAGXXXXXXXXXG
AGAGANKTDPSVEFVSYDNPRTTRAKAAYIEQRRLGGAFYWEAAGDKNGSHSLVRTMAAALRGLHGTRKNMLSYP
ESRYQNIRNGLGRGAN*
Coding >OphauB2|4944
ATGCTGGATCGTCTTGTTATTGCAGGCTGGATGCTTGCTGGTGTGGCATTGGGCCAGGGAGTTGAGAAGCAGAGT
TATCGAAGCGAGAATGCGACGCAGCGCAATGCGCTCTACTTTACAAACTGGGGCATCTACAAGGCGAATTTCCAG
CCTGAGCAACTACCCGTCAAGGACATTACTCATGTGCTCTATGCGTTTGGAGACATTTCGGAAAACGGCACGGTA
GTATCGACGGATAGCTACGCCGACTTGGAGAAGCACTACGCGGGCGACTCGTGGGCCGAGACGGGGCACAATGCC
TATGGCTGTGTGAAGCAGCTATATGCGCTCAAGCAGCAGAACCGACACCTCAAGGTGCTGTACTCGATTGGCGGC
TTCAGCGCCTCTGAACAGGGCCACTTTGCATACGCAGCGTCGACAGCCTCGCGGCGGCGAATATTCGCACAGTCG
GCCGTCAAGATTGTAGCAGACTGGGGACTAGACGGACTAGACATTGACTGGGAGTTTGCGCGCAACGGCAGCGAG
GCGACGCAGCTAGTACAGCTCCTGGAAGCGTGCCGAGAGGAACTAGACAAGTACGCGGCGCGGCTGGGCCAAGCA
TACCACTATGAGCTCAGCGTGGCGTCGTCGGCGGGCAAGCAGCACTACAGCAAGCTGCATCTCAAAGAAATGGAC
GCGGTGCTGGATGCGTGGCACCTCATGGCGTACGACTATGCAGGACCGTGGGATGCCACGGCAGGCCATCAGGCA
AGTCTGCATCACGACGCGGCGAATCCCACCAGCACCAAGTTTTGCACCGAGCAGGCCGTGGAGGATTACCTGGCG
GCGGGGGTTCCGGCGCACAAGCTCATTCTCGGACTGCCGCTCTATGGACGCTCGTTTGCGCGCGCGGGGGGACCG
GGAAGCAGCTTTGCTGGACCGGGGGGCGGTTCCTTGCAAGACGGTGTGTGGCTCTATCGCGATTTGCCGCGTCCC
GGGGCGAGGGAGTATACGAGCGATGCCCTGGCGGTGGCGTGGAGTGTCGGTAGCGAGGCTTCAACTGGTGGTGGT
GGTGGTGGTGATGGTGGTGGTGATGGTGGTGGTGTTGGTGCTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNGGT
GCGGGTGCGGGTGCAAACAAAACCGACCCAAGTGTCGAATTCGTCTCGTACGATAATCCGCGCACCACGCGCGCC
AAGGCGGCCTACATTGAGCAGCGACGCCTCGGCGGGGCCTTTTACTGGGAAGCGGCAGGCGATAAAAATGGCTCG
CATAGTCTGGTGCGCACCATGGCGGCGGCGCTGCGTGGCCTCCATGGCACGCGTAAAAACATGCTGAGCTATCCC
GAGAGTCGCTATCAAAATATCCGCAATGGGTTGGGCCGAGGCGCAAACTAG
Transcript >OphauB2|4944
ATGCTGGATCGTCTTGTTATTGCAGGCTGGATGCTTGCTGGTGTGGCATTGGGCCAGGGAGTTGAGAAGCAGAGT
TATCGAAGCGAGAATGCGACGCAGCGCAATGCGCTCTACTTTACAAACTGGGGCATCTACAAGGCGAATTTCCAG
CCTGAGCAACTACCCGTCAAGGACATTACTCATGTGCTCTATGCGTTTGGAGACATTTCGGAAAACGGCACGGTA
GTATCGACGGATAGCTACGCCGACTTGGAGAAGCACTACGCGGGCGACTCGTGGGCCGAGACGGGGCACAATGCC
TATGGCTGTGTGAAGCAGCTATATGCGCTCAAGCAGCAGAACCGACACCTCAAGGTGCTGTACTCGATTGGCGGC
TTCAGCGCCTCTGAACAGGGCCACTTTGCATACGCAGCGTCGACAGCCTCGCGGCGGCGAATATTCGCACAGTCG
GCCGTCAAGATTGTAGCAGACTGGGGACTAGACGGACTAGACATTGACTGGGAGTTTGCGCGCAACGGCAGCGAG
GCGACGCAGCTAGTACAGCTCCTGGAAGCGTGCCGAGAGGAACTAGACAAGTACGCGGCGCGGCTGGGCCAAGCA
TACCACTATGAGCTCAGCGTGGCGTCGTCGGCGGGCAAGCAGCACTACAGCAAGCTGCATCTCAAAGAAATGGAC
GCGGTGCTGGATGCGTGGCACCTCATGGCGTACGACTATGCAGGACCGTGGGATGCCACGGCAGGCCATCAGGCA
AGTCTGCATCACGACGCGGCGAATCCCACCAGCACCAAGTTTTGCACCGAGCAGGCCGTGGAGGATTACCTGGCG
GCGGGGGTTCCGGCGCACAAGCTCATTCTCGGACTGCCGCTCTATGGACGCTCGTTTGCGCGCGCGGGGGGACCG
GGAAGCAGCTTTGCTGGACCGGGGGGCGGTTCCTTGCAAGACGGTGTGTGGCTCTATCGCGATTTGCCGCGTCCC
GGGGCGAGGGAGTATACGAGCGATGCCCTGGCGGTGGCGTGGAGTGTCGGTAGCGAGGCTTCAACTGGTGGTGGT
GGTGGTGGTGATGGTGGTGGTGATGGTGGTGGTGTTGGTGCTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNGGT
GCGGGTGCGGGTGCAAACAAAACCGACCCAAGTGTCGAATTCGTCTCGTACGATAATCCGCGCACCACGCGCGCC
AAGGCGGCCTACATTGAGCAGCGACGCCTCGGCGGGGCCTTTTACTGGGAAGCGGCAGGCGATAAAAATGGCTCG
CATAGTCTGGTGCGCACCATGGCGGCGGCGCTGCGTGGCCTCCATGGCACGCGTAAAAACATGCTGAGCTATCCC
GAGAGTCGCTATCAAAATATCCGCAATGGGTTGGGCCGAGGCGCAAACTAG
Gene >OphauB2|4944
ATGCTGGATCGTCTTGTTATTGCAGGCTGGATGCTTGCTGGTGTGGCATTGGGCCAGGGAGTTGAGAAGCAGAGT
TATCGAAGCGAGAATGCGACGCAGCGCAATGCGCTCTACTTTACAAACTGGTGAGTCGAAGAAGGGGCAACAAGT
TGGGAGCAAACAAGGGTGGTATGCTAAAGGAGGGGATATAGGGGCATCTACAAGGCGAATTTCCAGCCTGAGCAA
CTACCCGTCAAGGACATTACTCATGTGCTCTATGCGTTTGGAGACATTTCGGAAAACGGCACGGTGTAAGTGAGA
GGGCGCTTGTGTAGAAGGGGAGAGAGCTCGACTAAGTGGAGGGGGCAGAGTATCGACGGATAGCTACGCCGACTT
GGAGAAGCACTACGCGGGCGACTCGTGGGCCGAGACGGGGCACAATGCCTATGGCTGTGTGAAGCAGCTATATGC
GCTCAAGCAGCAGAACCGACACCTCAAGGTGCTGTACTCGATTGGCGGCTTCAGCGCCTCTGAACAGGGCCACTT
TGCATACGCAGCGTCGACAGCCTCGCGGCGGCGAATATTCGCACAGTCGGCCGTCAAGATTGTAGCAGACTGGGG
ACTAGACGGACTAGACATTGACTGGGAGTTTGCGCGCAACGGCAGCGAGGCGACGCAGCTAGTACAGCTCCTGGA
AGCGTGCCGAGAGGAACTAGACAAGTACGCGGCGCGGCTGGGCCAAGCATACCACTATGAGCTCAGCGTGGCGTC
GTCGGCGGGCAAGCAGCACTACAGCAAGCTGCATCTCAAAGAAATGGACGCGGTGCTGGATGCGTGGCACCTCAT
GGCGTACGACTATGCAGGACCGTGGGATGCCACGGCAGGCCATCAGGCAAGTCTGCATCACGACGCGGCGAATCC
CACCAGCACCAAGTTTTGCACCGAGCAGGCCGTGGAGGATTACCTGGCGGCGGGGGTTCCGGCGCACAAGCTCAT
TCTCGGACTGCCGCTCTATGGACGCTCGTTTGCGCGCGCGGGGGGACCGGGAAGCAGCTTTGCTGGACCGGGGGG
CGGTTCCTTGCAAGACGGTGTGTGGCTCTATCGCGATTTGCCGCGTCCCGGGGCGAGGGAGTATACGAGCGATGC
CCTGGCGGTGGCGTGGAGTGTCGGTAGCGAGGCTTCAACTGGTGGTGGTGGTGGTGGTGATGGTGGTGGTGATGG
TGGTGGTGTTGGTGCTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGCGGGTGCGGGTGCAAACAAAACCGA
CCCAAGTGTCGAATTCGTCTCGTACGATAATCCGCGCACCACGCGCGCCAAGGCGGCCTACATTGAGCAGCGACG
CCTCGGCGGGGCCTTTTACTGGGAAGCGGCAGGCGATAAAAATGGCTCGCATAGTCTGGTGCGCACCATGGCGGC
GGCGCTGCGTGGCCTCCATGGCACGCGTAAAAACATGCTGAGCTATCCCGAGAGTCGCTATCAAAATATCCGCAA
TGGGTTGGGCCGAGGCGCAAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail