Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4941
Gene name
LocationContig_35:119672..122392
Strand+
Gene length (bp)2720
Transcript length (bp)2478
Coding sequence length (bp)2478
Protein length (aa) 826

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12066 SERRATE_Ars2_N SERRATE/Ars2, N-terminal domain 2.8E-35 146 251
PF13821 DUF4187 Domain of unknown function (DUF4187) 5.6E-12 501 546
PF04959 ARS2 Arsenite-resistance protein 2 1.0E-09 593 759

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 42 670 1.0E-20
sp|B1H1X4|SRRTA_XENLA Serrate RNA effector molecule homolog A OS=Xenopus laevis GN=srrt-a PE=2 SV=1 280 668 6.0E-11
sp|Q6INH5|SRRTB_XENLA Serrate RNA effector molecule homolog B OS=Xenopus laevis GN=srrt-b PE=2 SV=1 280 668 2.0E-09
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 513 700 1.0E-08
sp|B4J497|SRRT_DROGR Serrate RNA effector molecule homolog OS=Drosophila grimshawi GN=Ars2 PE=3 SV=1 513 700 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 42 670 1.0E-20
sp|B1H1X4|SRRTA_XENLA Serrate RNA effector molecule homolog A OS=Xenopus laevis GN=srrt-a PE=2 SV=1 280 668 6.0E-11
sp|Q6INH5|SRRTB_XENLA Serrate RNA effector molecule homolog B OS=Xenopus laevis GN=srrt-b PE=2 SV=1 280 668 2.0E-09
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 513 700 1.0E-08
sp|B4J497|SRRT_DROGR Serrate RNA effector molecule homolog OS=Drosophila grimshawi GN=Ars2 PE=3 SV=1 513 700 3.0E-08
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 513 690 4.0E-08
sp|B4LIK8|SRRT_DROVI Serrate RNA effector molecule homolog OS=Drosophila virilis GN=Ars2 PE=3 SV=1 513 700 6.0E-08
sp|A8XEG9|SRRT_CAEBR Serrate RNA effector molecule homolog OS=Caenorhabditis briggsae GN=CBG12064 PE=3 SV=1 163 674 1.0E-07
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 513 724 2.0E-07
sp|Q99MR6|SRRT_MOUSE Serrate RNA effector molecule homolog OS=Mus musculus GN=Srrt PE=1 SV=1 500 813 3.0E-07
sp|Q9BXP5|SRRT_HUMAN Serrate RNA effector molecule homolog OS=Homo sapiens GN=SRRT PE=1 SV=1 500 813 3.0E-07
sp|A4IFB1|SRRT_BOVIN Serrate RNA effector molecule homolog OS=Bos taurus GN=SRRT PE=2 SV=1 500 813 3.0E-07
sp|Q5R539|SRRT_PONAB Serrate RNA effector molecule homolog OS=Pongo abelii GN=SRRT PE=2 SV=1 500 813 4.0E-07
sp|B4H732|SRRT_DROPE Serrate RNA effector molecule homolog OS=Drosophila persimilis GN=Ars2 PE=3 SV=1 513 700 8.0E-07
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 500 813 8.0E-07
sp|B4NYV0|SRRT_DROYA Serrate RNA effector molecule homolog OS=Drosophila yakuba GN=Ars2 PE=3 SV=1 483 669 9.0E-07
sp|Q28WQ8|SRRT_DROPS Serrate RNA effector molecule homolog OS=Drosophila pseudoobscura pseudoobscura GN=Ars2 PE=3 SV=2 513 700 9.0E-07
sp|B4QCR6|SRRT_DROSI Serrate RNA effector molecule homolog OS=Drosophila simulans GN=Ars2 PE=3 SV=1 513 700 1.0E-06
sp|Q66I22|SRRT_DANRE Serrate RNA effector molecule homolog OS=Danio rerio GN=srrt PE=2 SV=1 511 668 1.0E-06
sp|Q9V9K7|SRRT_DROME Serrate RNA effector molecule homolog OS=Drosophila melanogaster GN=Ars2 PE=1 SV=2 513 669 2.0E-06
sp|B3MJ69|SRRT_DROAN Serrate RNA effector molecule homolog OS=Drosophila ananassae GN=Ars2 PE=3 SV=1 513 701 2.0E-06
sp|B4II37|SRRT_DROSE Serrate RNA effector molecule homolog OS=Drosophila sechellia GN=Ars2 PE=3 SV=2 513 669 5.0E-06
sp|B3N3F7|SRRT_DROER Serrate RNA effector molecule homolog OS=Drosophila erecta GN=Ars2 PE=3 SV=1 513 669 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4941
MDSYTSHRESSFRSPHDRSWGREDREERSDNSYRSNNATERRDRRRSRSPAPIDRYEPRTRRDDRDRDDRRRVIS
PPANIDRYVPGADGASPAVTVNPLTDPSRFQYQVGFSYFGEWWRLNEKIKDEKERARSGRRREPDRNRGPRDLQE
EREKEKAKIQAAYDAYKEDLQGKMARAFVSEHKKEQWFRERYVPEVRDDFRAKLNEMRRGAYSQWEQDLESGTFD
HFALEGLLKSESNGAGGTVEKEEGEATAGNEIMGVGDLMPSSGADIRDENQFQPTLLIKTIAPHVSRQNLEAFCK
ENLGEEEGGFKWLSLSDPNPSKRYHRIGWVMLHPSSETAMPVDRADPKDEDDEMEIKSPQPISTADKALEAVNGK
TVKDEVRGDFVCHVGVHVPPSHPRKKALWDLFSAPERIEKDLSLVQRLVNKFEEDFGSDFQAILKVEEKVLDLRN
AGLLQPVVNSTAPKKPKKEREALDEAMDNEEGIVEEEDEEEDGAIDEDDDVDDEDVLIKKKQLDLLIEYLRRVFN
FCFFCVFESDSIHELTRKCPGGHLRRPRSSLSSTARSVARATVNGEPFPDKRRKDSIEEGQQLLRASVDLRKLGG
RSVEEAVDEELAKHVKQEDEHKWRCKVPECTKLFKEEHFWKKHVEKRHSEWLDSMKQEFELINAYVMDPAHIAPS
RTDASSNGHFPPSSGQPISGTPRGFNLAQLNNMNGMIGIPGFPIPPGGFPMFPNMQAPNWTPPMGDDRSGGVIRR
GGMGGNRGQFRSGPYERRGGHRWDAGGRQRIGGSRWGDGAGGAAGGPREAVQGRSLKSYEDLDQVSGGGDGELNY
*
Coding >OphauB2|4941
ATGGACTCGTACACTTCTCATCGTGAGTCATCTTTTAGGTCGCCTCACGACCGAAGTTGGGGCCGCGAAGATCGA
GAGGAACGCTCCGACAACTCGTACCGTAGCAACAATGCAACTGAGCGGAGAGATCGCCGACGCTCGCGCTCTCCA
GCTCCCATCGACCGCTACGAGCCGCGAACGCGAAGGGACGACCGCGACCGAGATGATCGCCGGCGTGTGATTTCA
CCTCCAGCCAACATTGATCGCTATGTTCCCGGCGCCGATGGTGCTTCTCCTGCCGTCACGGTCAACCCTCTGACC
GATCCCAGTCGCTTCCAATATCAGGTTGGCTTTTCCTATTTTGGGGAATGGTGGAGGCTCAATGAAAAGATCAAG
GATGAAAAAGAGCGTGCTCGCTCTGGCCGCAGACGAGAACCTGATCGTAACCGAGGCCCCCGCGACCTTCAGGAG
GAGCGCGAAAAGGAAAAGGCCAAGATTCAGGCCGCCTACGATGCCTACAAGGAAGACTTGCAGGGTAAAATGGCC
CGCGCCTTTGTATCCGAACACAAAAAGGAGCAATGGTTTCGCGAGAGATACGTGCCCGAGGTCAGGGATGACTTT
CGGGCTAAGCTGAATGAGATGCGGCGAGGAGCCTACAGTCAGTGGGAACAAGATCTCGAGTCTGGCACCTTTGAC
CACTTTGCACTGGAAGGTCTTCTTAAAAGCGAAAGCAACGGTGCAGGTGGCACGGTGGAAAAGGAAGAAGGCGAG
GCCACGGCGGGCAATGAAATCATGGGCGTGGGTGATCTCATGCCATCTAGCGGGGCCGACATTCGCGATGAGAAC
CAGTTCCAGCCGACGCTGCTTATCAAGACAATTGCGCCTCATGTCAGTCGTCAGAATCTGGAGGCCTTCTGTAAG
GAAAACCTGGGAGAGGAAGAGGGCGGTTTCAAATGGTTATCGCTCTCAGATCCGAATCCCAGCAAACGCTATCAT
CGCATTGGCTGGGTAATGCTGCATCCTTCATCCGAAACAGCAATGCCAGTCGATCGCGCCGACCCCAAGGACGAA
GACGACGAAATGGAAATCAAGTCTCCACAGCCCATCTCTACCGCCGATAAGGCTCTCGAGGCGGTCAATGGAAAG
ACTGTCAAGGACGAGGTCCGAGGTGATTTTGTCTGTCACGTAGGCGTTCATGTCCCGCCCTCGCATCCGCGAAAG
AAAGCTTTGTGGGATCTGTTTTCTGCTCCAGAACGCATTGAAAAAGACTTGTCTCTAGTTCAGCGCCTTGTCAAC
AAATTCGAGGAAGACTTCGGGTCCGACTTTCAAGCAATTCTCAAAGTGGAAGAAAAAGTGTTGGATCTCCGCAAC
GCTGGCTTACTTCAACCCGTCGTTAACTCTACGGCGCCCAAAAAGCCAAAGAAGGAGCGAGAGGCACTAGACGAA
GCAATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGAT
GTGGATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAAC
TTCTGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGT
AGACCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGAC
AAGAGGCGCAAGGATAGCATTGAAGAGGGACAGCAACTTCTGCGAGCTTCTGTTGATCTTCGTAAACTCGGCGGA
CGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAGCATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGC
AAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACATTTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAG
TGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAATGCCTACGTTATGGACCCTGCCCATATTGCTCCCTCG
CGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTC
AACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCC
ATGTTTCCCAACATGCAAGCTCCTAATTGGACGCCACCCATGGGGGACGACCGCTCGGGAGGTGTGATTCGGCGG
GGTGGCATGGGCGGCAACCGTGGGCAGTTTCGCTCAGGGCCTTATGAGCGCCGCGGCGGCCATCGCTGGGACGCC
GGGGGACGACAACGCATTGGAGGATCCCGTTGGGGCGACGGCGCTGGCGGAGCGGCTGGAGGCCCGCGGGAAGCA
GTTCAAGGAAGGAGCCTGAAGAGCTACGAGGATCTCGATCAGGTCTCGGGAGGTGGCGACGGGGAGCTCAATTAC
TAA
Transcript >OphauB2|4941
ATGGACTCGTACACTTCTCATCGTGAGTCATCTTTTAGGTCGCCTCACGACCGAAGTTGGGGCCGCGAAGATCGA
GAGGAACGCTCCGACAACTCGTACCGTAGCAACAATGCAACTGAGCGGAGAGATCGCCGACGCTCGCGCTCTCCA
GCTCCCATCGACCGCTACGAGCCGCGAACGCGAAGGGACGACCGCGACCGAGATGATCGCCGGCGTGTGATTTCA
CCTCCAGCCAACATTGATCGCTATGTTCCCGGCGCCGATGGTGCTTCTCCTGCCGTCACGGTCAACCCTCTGACC
GATCCCAGTCGCTTCCAATATCAGGTTGGCTTTTCCTATTTTGGGGAATGGTGGAGGCTCAATGAAAAGATCAAG
GATGAAAAAGAGCGTGCTCGCTCTGGCCGCAGACGAGAACCTGATCGTAACCGAGGCCCCCGCGACCTTCAGGAG
GAGCGCGAAAAGGAAAAGGCCAAGATTCAGGCCGCCTACGATGCCTACAAGGAAGACTTGCAGGGTAAAATGGCC
CGCGCCTTTGTATCCGAACACAAAAAGGAGCAATGGTTTCGCGAGAGATACGTGCCCGAGGTCAGGGATGACTTT
CGGGCTAAGCTGAATGAGATGCGGCGAGGAGCCTACAGTCAGTGGGAACAAGATCTCGAGTCTGGCACCTTTGAC
CACTTTGCACTGGAAGGTCTTCTTAAAAGCGAAAGCAACGGTGCAGGTGGCACGGTGGAAAAGGAAGAAGGCGAG
GCCACGGCGGGCAATGAAATCATGGGCGTGGGTGATCTCATGCCATCTAGCGGGGCCGACATTCGCGATGAGAAC
CAGTTCCAGCCGACGCTGCTTATCAAGACAATTGCGCCTCATGTCAGTCGTCAGAATCTGGAGGCCTTCTGTAAG
GAAAACCTGGGAGAGGAAGAGGGCGGTTTCAAATGGTTATCGCTCTCAGATCCGAATCCCAGCAAACGCTATCAT
CGCATTGGCTGGGTAATGCTGCATCCTTCATCCGAAACAGCAATGCCAGTCGATCGCGCCGACCCCAAGGACGAA
GACGACGAAATGGAAATCAAGTCTCCACAGCCCATCTCTACCGCCGATAAGGCTCTCGAGGCGGTCAATGGAAAG
ACTGTCAAGGACGAGGTCCGAGGTGATTTTGTCTGTCACGTAGGCGTTCATGTCCCGCCCTCGCATCCGCGAAAG
AAAGCTTTGTGGGATCTGTTTTCTGCTCCAGAACGCATTGAAAAAGACTTGTCTCTAGTTCAGCGCCTTGTCAAC
AAATTCGAGGAAGACTTCGGGTCCGACTTTCAAGCAATTCTCAAAGTGGAAGAAAAAGTGTTGGATCTCCGCAAC
GCTGGCTTACTTCAACCCGTCGTTAACTCTACGGCGCCCAAAAAGCCAAAGAAGGAGCGAGAGGCACTAGACGAA
GCAATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGAT
GTGGATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAAC
TTCTGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGT
AGACCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGAC
AAGAGGCGCAAGGATAGCATTGAAGAGGGACAGCAACTTCTGCGAGCTTCTGTTGATCTTCGTAAACTCGGCGGA
CGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAGCATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGC
AAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACATTTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAG
TGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAATGCCTACGTTATGGACCCTGCCCATATTGCTCCCTCG
CGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTC
AACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCC
ATGTTTCCCAACATGCAAGCTCCTAATTGGACGCCACCCATGGGGGACGACCGCTCGGGAGGTGTGATTCGGCGG
GGTGGCATGGGCGGCAACCGTGGGCAGTTTCGCTCAGGGCCTTATGAGCGCCGCGGCGGCCATCGCTGGGACGCC
GGGGGACGACAACGCATTGGAGGATCCCGTTGGGGCGACGGCGCTGGCGGAGCGGCTGGAGGCCCGCGGGAAGCA
GTTCAAGGAAGGAGCCTGAAGAGCTACGAGGATCTCGATCAGGTCTCGGGAGGTGGCGACGGGGAGCTCAATTAC
TAA
Gene >OphauB2|4941
ATGGACTCGTACACTTCTCATCGTGAGTCATCTTTTAGGTCGCCTCACGACCGAAGTTGGGGCCGCGAAGATCGA
GAGGAACGCTCCGACAACTCGTACCGTAGCAACAATGGTACGTTTATCAGCTCTCTACAAACTTGCTTCATTCCA
ATCTTGGCAGACAGCTGACTAGCACCCAGCAACTGAGCGGAGAGATCGCCGACGCTCGCGCTCTCCAGCTCCCAT
CGACCGCTACGAGCCGCGAACGCGAAGGGACGACCGCGACCGAGATGATCGCCGGCGTGTGATTTCACCTCCAGC
CAACATTGATCGCTATGTTCCCGGCGCCGATGGTGCTTCTCCTGCCGTCACGGTCAACCCTCTGACCGATCCCAG
TCGCTTCCAATATCAGGTTGGCTTTTCCTATTTTGGGGAATGGTGGAGGCTCAATGAAAAGATCAAGGATGAAAA
AGAGCGTGCTCGCTCTGGCCGCAGACGAGAACCTGATCGTAACCGAGGCCCCCGCGACCTTCAGGAGGAGCGCGA
AAAGGAAAAGGCCAAGATTCAGGCCGCCTACGATGCCTACAAGGAAGACTTGCAGGGTAAAATGGCCCGCGCCTT
TGTATCCGAACACAAAAAGGAGCAATGGTTTCGCGAGAGATACGTGCCCGAGGTCAGGGATGACTTTCGGGCTAA
GCTGAATGAGATGCGGCGAGGAGCCTACAGTCAGTGGGAACAAGATCTCGAGTCTGGCACCTTTGACCACTTTGC
ACTGGAAGGTCTTCTTAAAAGCGAAAGCAACGGTGCAGGTGGCACGGTGGAAAAGGAAGAAGGCGAGGCCACGGC
GGGCAATGAAATCATGGGCGTGGGTGATCTCATGCCATCTAGCGGGGCCGACATTCGCGATGAGAACCAGTTCCA
GCCGACGCTGCTTATCAAGACAATTGCGCCTCATGTCAGTCGTCAGAATCTGGAGGCCTTCTGTAAGGAAAACCT
GGGAGAGGAAGAGGGCGGTTTCAAATGGTTATCGCTCTCAGATCCGAATCCCAGCAAACGCTATCATCGCATTGG
CTGGGTAATGCTGCATCCTTCATCCGAAACAGCAATGCCAGTCGATCGCGCCGACCCCAAGGACGAAGACGACGA
AATGGAAATCAAGTCTCCACAGCCCATCTCTACCGCCGATAAGGCTCTCGAGGCGGTCAATGGAAAGACTGTCAA
GGACGAGGTCCGAGGTGATTTTGTCTGTCACGTAGGCGTTCATGTCCCGCCCTCGCATCCGCGAAAGAAAGCTTT
GTGGGATCTGTTTTCTGCTCCAGAACGCATTGAAAAAGACTTGTCTCTAGTTCAGCGCCTTGTCAACAAATTCGA
GGAAGACTTCGGGTCCGACTTTCAAGCAATTCTCAAAGTGGAAGAAAAAGTGTTGGATCTCCGCAACGCTGGCTT
ACTTCAACCCGTCGTTAACTCTACGGCGCCCAAAAAGCCAAAGAAGGAGCGAGAGGCACTAGACGAAGCAATGGA
TAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTGGATGA
CGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTCTGCTT
CTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGACCTCG
GAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAGAGGCG
CAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCGAGCAA
GACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTGGACTC
CAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAGCATGT
CAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACATTTTTG
GAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGGTAAGGCTGCCACGCGGTAA
ATGCTGTCCACTGGCCTTTTTAACTGACCCCCATGACACAGTTTGAGCTCATAAATGCCTACGTTATGGACCCTG
CCCATATTGCTCCCTCGCGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAATCTCTG
GTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCCCATTC
CTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAATTGGACGCCACCCATGGGGGACGACCGCTCGG
GAGGTGTGATTCGGCGGGGTGGCATGGGCGGCAACCGTGGGCAGTTTCGCTCAGGGCCTTATGAGCGCCGCGGCG
GCCATCGCTGGGACGCCGGGGGACGACAACGCATTGGAGGATCCCGTTGGGGCGACGGCGCTGGCGGAGCGGCTG
GAGGCCCGCGGGAAGCAGTTCAAGGAAGGAGCCTGAAGAGCTACGAGGATCTCGATCAGGTCTCGGGAGGTGGCG
ACGGGGAGCTCAATTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail