Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4941
Gene name
LocationContig_35:119672..122392
Strand+
Gene length (bp)2720
Transcript length (bp)2478
Coding sequence length (bp)2478
Protein length (aa) 826

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12066 SERRATE_Ars2_N SERRATE/Ars2, N-terminal domain 2.8E-35 146 251
PF13821 DUF4187 Domain of unknown function (DUF4187) 5.6E-12 501 546
PF04959 ARS2 Arsenite-resistance protein 2 1.0E-09 593 759

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 42 670 1.0E-20
sp|B1H1X4|SRRTA_XENLA Serrate RNA effector molecule homolog A OS=Xenopus laevis GN=srrt-a PE=2 SV=1 280 668 6.0E-11
sp|Q6INH5|SRRTB_XENLA Serrate RNA effector molecule homolog B OS=Xenopus laevis GN=srrt-b PE=2 SV=1 280 668 2.0E-09
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 513 700 1.0E-08
sp|B4J497|SRRT_DROGR Serrate RNA effector molecule homolog OS=Drosophila grimshawi GN=Ars2 PE=3 SV=1 513 700 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 42 670 1.0E-20
sp|B1H1X4|SRRTA_XENLA Serrate RNA effector molecule homolog A OS=Xenopus laevis GN=srrt-a PE=2 SV=1 280 668 6.0E-11
sp|Q6INH5|SRRTB_XENLA Serrate RNA effector molecule homolog B OS=Xenopus laevis GN=srrt-b PE=2 SV=1 280 668 2.0E-09
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 513 700 1.0E-08
sp|B4J497|SRRT_DROGR Serrate RNA effector molecule homolog OS=Drosophila grimshawi GN=Ars2 PE=3 SV=1 513 700 3.0E-08
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 513 690 4.0E-08
sp|B4LIK8|SRRT_DROVI Serrate RNA effector molecule homolog OS=Drosophila virilis GN=Ars2 PE=3 SV=1 513 700 6.0E-08
sp|A8XEG9|SRRT_CAEBR Serrate RNA effector molecule homolog OS=Caenorhabditis briggsae GN=CBG12064 PE=3 SV=1 163 674 1.0E-07
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 513 724 2.0E-07
sp|Q99MR6|SRRT_MOUSE Serrate RNA effector molecule homolog OS=Mus musculus GN=Srrt PE=1 SV=1 500 813 3.0E-07
sp|Q9BXP5|SRRT_HUMAN Serrate RNA effector molecule homolog OS=Homo sapiens GN=SRRT PE=1 SV=1 500 813 3.0E-07
sp|A4IFB1|SRRT_BOVIN Serrate RNA effector molecule homolog OS=Bos taurus GN=SRRT PE=2 SV=1 500 813 3.0E-07
sp|Q5R539|SRRT_PONAB Serrate RNA effector molecule homolog OS=Pongo abelii GN=SRRT PE=2 SV=1 500 813 4.0E-07
sp|B4H732|SRRT_DROPE Serrate RNA effector molecule homolog OS=Drosophila persimilis GN=Ars2 PE=3 SV=1 513 700 8.0E-07
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 500 813 8.0E-07
sp|B4NYV0|SRRT_DROYA Serrate RNA effector molecule homolog OS=Drosophila yakuba GN=Ars2 PE=3 SV=1 483 669 9.0E-07
sp|Q28WQ8|SRRT_DROPS Serrate RNA effector molecule homolog OS=Drosophila pseudoobscura pseudoobscura GN=Ars2 PE=3 SV=2 513 700 9.0E-07
sp|B4QCR6|SRRT_DROSI Serrate RNA effector molecule homolog OS=Drosophila simulans GN=Ars2 PE=3 SV=1 513 700 1.0E-06
sp|Q66I22|SRRT_DANRE Serrate RNA effector molecule homolog OS=Danio rerio GN=srrt PE=2 SV=1 511 668 1.0E-06
sp|Q9V9K7|SRRT_DROME Serrate RNA effector molecule homolog OS=Drosophila melanogaster GN=Ars2 PE=1 SV=2 513 669 2.0E-06
sp|B3MJ69|SRRT_DROAN Serrate RNA effector molecule homolog OS=Drosophila ananassae GN=Ars2 PE=3 SV=1 513 701 2.0E-06
sp|B4II37|SRRT_DROSE Serrate RNA effector molecule homolog OS=Drosophila sechellia GN=Ars2 PE=3 SV=2 513 669 5.0E-06
sp|B3N3F7|SRRT_DROER Serrate RNA effector molecule homolog OS=Drosophila erecta GN=Ars2 PE=3 SV=1 513 669 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup988
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5546
Ophiocordyceps australis map64 (Brazil) OphauB2|4941 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6381
Ophiocordyceps camponoti-floridani Ophcf2|07339
Ophiocordyceps camponoti-rufipedis Ophun1|865
Ophiocordyceps kimflemingae Ophio5|1518
Ophiocordyceps subramaniannii Hirsu2|8203

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4941
MDSYTSHRESSFRSPHDRSWGREDREERSDNSYRSNNATERRDRRRSRSPAPIDRYEPRTRRDDRDRDDRRRVIS
PPANIDRYVPGADGASPAVTVNPLTDPSRFQYQVGFSYFGEWWRLNEKIKDEKERARSGRRREPDRNRGPRDLQE
EREKEKAKIQAAYDAYKEDLQGKMARAFVSEHKKEQWFRERYVPEVRDDFRAKLNEMRRGAYSQWEQDLESGTFD
HFALEGLLKSESNGAGGTVEKEEGEATAGNEIMGVGDLMPSSGADIRDENQFQPTLLIKTIAPHVSRQNLEAFCK
ENLGEEEGGFKWLSLSDPNPSKRYHRIGWVMLHPSSETAMPVDRADPKDEDDEMEIKSPQPISTADKALEAVNGK
TVKDEVRGDFVCHVGVHVPPSHPRKKALWDLFSAPERIEKDLSLVQRLVNKFEEDFGSDFQAILKVEEKVLDLRN
AGLLQPVVNSTAPKKPKKEREALDEAMDNEEGIVEEEDEEEDGAIDEDDDVDDEDVLIKKKQLDLLIEYLRRVFN
FCFFCVFESDSIHELTRKCPGGHLRRPRSSLSSTARSVARATVNGEPFPDKRRKDSIEEGQQLLRASVDLRKLGG
RSVEEAVDEELAKHVKQEDEHKWRCKVPECTKLFKEEHFWKKHVEKRHSEWLDSMKQEFELINAYVMDPAHIAPS
RTDASSNGHFPPSSGQPISGTPRGFNLAQLNNMNGMIGIPGFPIPPGGFPMFPNMQAPNWTPPMGDDRSGGVIRR
GGMGGNRGQFRSGPYERRGGHRWDAGGRQRIGGSRWGDGAGGAAGGPREAVQGRSLKSYEDLDQVSGGGDGELNY
*
Coding >OphauB2|4941
ATGGACTCGTACACTTCTCATCGTGAGTCATCTTTTAGGTCGCCTCACGACCGAAGTTGGGGCCGCGAAGATCGA
GAGGAACGCTCCGACAACTCGTACCGTAGCAACAATGCAACTGAGCGGAGAGATCGCCGACGCTCGCGCTCTCCA
GCTCCCATCGACCGCTACGAGCCGCGAACGCGAAGGGACGACCGCGACCGAGATGATCGCCGGCGTGTGATTTCA
CCTCCAGCCAACATTGATCGCTATGTTCCCGGCGCCGATGGTGCTTCTCCTGCCGTCACGGTCAACCCTCTGACC
GATCCCAGTCGCTTCCAATATCAGGTTGGCTTTTCCTATTTTGGGGAATGGTGGAGGCTCAATGAAAAGATCAAG
GATGAAAAAGAGCGTGCTCGCTCTGGCCGCAGACGAGAACCTGATCGTAACCGAGGCCCCCGCGACCTTCAGGAG
GAGCGCGAAAAGGAAAAGGCCAAGATTCAGGCCGCCTACGATGCCTACAAGGAAGACTTGCAGGGTAAAATGGCC
CGCGCCTTTGTATCCGAACACAAAAAGGAGCAATGGTTTCGCGAGAGATACGTGCCCGAGGTCAGGGATGACTTT
CGGGCTAAGCTGAATGAGATGCGGCGAGGAGCCTACAGTCAGTGGGAACAAGATCTCGAGTCTGGCACCTTTGAC
CACTTTGCACTGGAAGGTCTTCTTAAAAGCGAAAGCAACGGTGCAGGTGGCACGGTGGAAAAGGAAGAAGGCGAG
GCCACGGCGGGCAATGAAATCATGGGCGTGGGTGATCTCATGCCATCTAGCGGGGCCGACATTCGCGATGAGAAC
CAGTTCCAGCCGACGCTGCTTATCAAGACAATTGCGCCTCATGTCAGTCGTCAGAATCTGGAGGCCTTCTGTAAG
GAAAACCTGGGAGAGGAAGAGGGCGGTTTCAAATGGTTATCGCTCTCAGATCCGAATCCCAGCAAACGCTATCAT
CGCATTGGCTGGGTAATGCTGCATCCTTCATCCGAAACAGCAATGCCAGTCGATCGCGCCGACCCCAAGGACGAA
GACGACGAAATGGAAATCAAGTCTCCACAGCCCATCTCTACCGCCGATAAGGCTCTCGAGGCGGTCAATGGAAAG
ACTGTCAAGGACGAGGTCCGAGGTGATTTTGTCTGTCACGTAGGCGTTCATGTCCCGCCCTCGCATCCGCGAAAG
AAAGCTTTGTGGGATCTGTTTTCTGCTCCAGAACGCATTGAAAAAGACTTGTCTCTAGTTCAGCGCCTTGTCAAC
AAATTCGAGGAAGACTTCGGGTCCGACTTTCAAGCAATTCTCAAAGTGGAAGAAAAAGTGTTGGATCTCCGCAAC
GCTGGCTTACTTCAACCCGTCGTTAACTCTACGGCGCCCAAAAAGCCAAAGAAGGAGCGAGAGGCACTAGACGAA
GCAATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGAT
GTGGATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAAC
TTCTGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGT
AGACCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGAC
AAGAGGCGCAAGGATAGCATTGAAGAGGGACAGCAACTTCTGCGAGCTTCTGTTGATCTTCGTAAACTCGGCGGA
CGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAGCATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGC
AAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACATTTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAG
TGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAATGCCTACGTTATGGACCCTGCCCATATTGCTCCCTCG
CGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTC
AACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCC
ATGTTTCCCAACATGCAAGCTCCTAATTGGACGCCACCCATGGGGGACGACCGCTCGGGAGGTGTGATTCGGCGG
GGTGGCATGGGCGGCAACCGTGGGCAGTTTCGCTCAGGGCCTTATGAGCGCCGCGGCGGCCATCGCTGGGACGCC
GGGGGACGACAACGCATTGGAGGATCCCGTTGGGGCGACGGCGCTGGCGGAGCGGCTGGAGGCCCGCGGGAAGCA
GTTCAAGGAAGGAGCCTGAAGAGCTACGAGGATCTCGATCAGGTCTCGGGAGGTGGCGACGGGGAGCTCAATTAC
TAA
Transcript >OphauB2|4941
ATGGACTCGTACACTTCTCATCGTGAGTCATCTTTTAGGTCGCCTCACGACCGAAGTTGGGGCCGCGAAGATCGA
GAGGAACGCTCCGACAACTCGTACCGTAGCAACAATGCAACTGAGCGGAGAGATCGCCGACGCTCGCGCTCTCCA
GCTCCCATCGACCGCTACGAGCCGCGAACGCGAAGGGACGACCGCGACCGAGATGATCGCCGGCGTGTGATTTCA
CCTCCAGCCAACATTGATCGCTATGTTCCCGGCGCCGATGGTGCTTCTCCTGCCGTCACGGTCAACCCTCTGACC
GATCCCAGTCGCTTCCAATATCAGGTTGGCTTTTCCTATTTTGGGGAATGGTGGAGGCTCAATGAAAAGATCAAG
GATGAAAAAGAGCGTGCTCGCTCTGGCCGCAGACGAGAACCTGATCGTAACCGAGGCCCCCGCGACCTTCAGGAG
GAGCGCGAAAAGGAAAAGGCCAAGATTCAGGCCGCCTACGATGCCTACAAGGAAGACTTGCAGGGTAAAATGGCC
CGCGCCTTTGTATCCGAACACAAAAAGGAGCAATGGTTTCGCGAGAGATACGTGCCCGAGGTCAGGGATGACTTT
CGGGCTAAGCTGAATGAGATGCGGCGAGGAGCCTACAGTCAGTGGGAACAAGATCTCGAGTCTGGCACCTTTGAC
CACTTTGCACTGGAAGGTCTTCTTAAAAGCGAAAGCAACGGTGCAGGTGGCACGGTGGAAAAGGAAGAAGGCGAG
GCCACGGCGGGCAATGAAATCATGGGCGTGGGTGATCTCATGCCATCTAGCGGGGCCGACATTCGCGATGAGAAC
CAGTTCCAGCCGACGCTGCTTATCAAGACAATTGCGCCTCATGTCAGTCGTCAGAATCTGGAGGCCTTCTGTAAG
GAAAACCTGGGAGAGGAAGAGGGCGGTTTCAAATGGTTATCGCTCTCAGATCCGAATCCCAGCAAACGCTATCAT
CGCATTGGCTGGGTAATGCTGCATCCTTCATCCGAAACAGCAATGCCAGTCGATCGCGCCGACCCCAAGGACGAA
GACGACGAAATGGAAATCAAGTCTCCACAGCCCATCTCTACCGCCGATAAGGCTCTCGAGGCGGTCAATGGAAAG
ACTGTCAAGGACGAGGTCCGAGGTGATTTTGTCTGTCACGTAGGCGTTCATGTCCCGCCCTCGCATCCGCGAAAG
AAAGCTTTGTGGGATCTGTTTTCTGCTCCAGAACGCATTGAAAAAGACTTGTCTCTAGTTCAGCGCCTTGTCAAC
AAATTCGAGGAAGACTTCGGGTCCGACTTTCAAGCAATTCTCAAAGTGGAAGAAAAAGTGTTGGATCTCCGCAAC
GCTGGCTTACTTCAACCCGTCGTTAACTCTACGGCGCCCAAAAAGCCAAAGAAGGAGCGAGAGGCACTAGACGAA
GCAATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGAT
GTGGATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAAC
TTCTGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGT
AGACCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGAC
AAGAGGCGCAAGGATAGCATTGAAGAGGGACAGCAACTTCTGCGAGCTTCTGTTGATCTTCGTAAACTCGGCGGA
CGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAGCATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGC
AAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACATTTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAG
TGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAATGCCTACGTTATGGACCCTGCCCATATTGCTCCCTCG
CGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTC
AACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCC
ATGTTTCCCAACATGCAAGCTCCTAATTGGACGCCACCCATGGGGGACGACCGCTCGGGAGGTGTGATTCGGCGG
GGTGGCATGGGCGGCAACCGTGGGCAGTTTCGCTCAGGGCCTTATGAGCGCCGCGGCGGCCATCGCTGGGACGCC
GGGGGACGACAACGCATTGGAGGATCCCGTTGGGGCGACGGCGCTGGCGGAGCGGCTGGAGGCCCGCGGGAAGCA
GTTCAAGGAAGGAGCCTGAAGAGCTACGAGGATCTCGATCAGGTCTCGGGAGGTGGCGACGGGGAGCTCAATTAC
TAA
Gene >OphauB2|4941
ATGGACTCGTACACTTCTCATCGTGAGTCATCTTTTAGGTCGCCTCACGACCGAAGTTGGGGCCGCGAAGATCGA
GAGGAACGCTCCGACAACTCGTACCGTAGCAACAATGGTACGTTTATCAGCTCTCTACAAACTTGCTTCATTCCA
ATCTTGGCAGACAGCTGACTAGCACCCAGCAACTGAGCGGAGAGATCGCCGACGCTCGCGCTCTCCAGCTCCCAT
CGACCGCTACGAGCCGCGAACGCGAAGGGACGACCGCGACCGAGATGATCGCCGGCGTGTGATTTCACCTCCAGC
CAACATTGATCGCTATGTTCCCGGCGCCGATGGTGCTTCTCCTGCCGTCACGGTCAACCCTCTGACCGATCCCAG
TCGCTTCCAATATCAGGTTGGCTTTTCCTATTTTGGGGAATGGTGGAGGCTCAATGAAAAGATCAAGGATGAAAA
AGAGCGTGCTCGCTCTGGCCGCAGACGAGAACCTGATCGTAACCGAGGCCCCCGCGACCTTCAGGAGGAGCGCGA
AAAGGAAAAGGCCAAGATTCAGGCCGCCTACGATGCCTACAAGGAAGACTTGCAGGGTAAAATGGCCCGCGCCTT
TGTATCCGAACACAAAAAGGAGCAATGGTTTCGCGAGAGATACGTGCCCGAGGTCAGGGATGACTTTCGGGCTAA
GCTGAATGAGATGCGGCGAGGAGCCTACAGTCAGTGGGAACAAGATCTCGAGTCTGGCACCTTTGACCACTTTGC
ACTGGAAGGTCTTCTTAAAAGCGAAAGCAACGGTGCAGGTGGCACGGTGGAAAAGGAAGAAGGCGAGGCCACGGC
GGGCAATGAAATCATGGGCGTGGGTGATCTCATGCCATCTAGCGGGGCCGACATTCGCGATGAGAACCAGTTCCA
GCCGACGCTGCTTATCAAGACAATTGCGCCTCATGTCAGTCGTCAGAATCTGGAGGCCTTCTGTAAGGAAAACCT
GGGAGAGGAAGAGGGCGGTTTCAAATGGTTATCGCTCTCAGATCCGAATCCCAGCAAACGCTATCATCGCATTGG
CTGGGTAATGCTGCATCCTTCATCCGAAACAGCAATGCCAGTCGATCGCGCCGACCCCAAGGACGAAGACGACGA
AATGGAAATCAAGTCTCCACAGCCCATCTCTACCGCCGATAAGGCTCTCGAGGCGGTCAATGGAAAGACTGTCAA
GGACGAGGTCCGAGGTGATTTTGTCTGTCACGTAGGCGTTCATGTCCCGCCCTCGCATCCGCGAAAGAAAGCTTT
GTGGGATCTGTTTTCTGCTCCAGAACGCATTGAAAAAGACTTGTCTCTAGTTCAGCGCCTTGTCAACAAATTCGA
GGAAGACTTCGGGTCCGACTTTCAAGCAATTCTCAAAGTGGAAGAAAAAGTGTTGGATCTCCGCAACGCTGGCTT
ACTTCAACCCGTCGTTAACTCTACGGCGCCCAAAAAGCCAAAGAAGGAGCGAGAGGCACTAGACGAAGCAATGGA
TAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTGGATGA
CGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTCTGCTT
CTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGACCTCG
GAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAGAGGCG
CAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCGAGCAA
GACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTGGACTC
CAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAGCATGT
CAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACATTTTTG
GAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGGTAAGGCTGCCACGCGGTAA
ATGCTGTCCACTGGCCTTTTTAACTGACCCCCATGACACAGTTTGAGCTCATAAATGCCTACGTTATGGACCCTG
CCCATATTGCTCCCTCGCGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAATCTCTG
GTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCCCATTC
CTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAATTGGACGCCACCCATGGGGGACGACCGCTCGG
GAGGTGTGATTCGGCGGGGTGGCATGGGCGGCAACCGTGGGCAGTTTCGCTCAGGGCCTTATGAGCGCCGCGGCG
GCCATCGCTGGGACGCCGGGGGACGACAACGCATTGGAGGATCCCGTTGGGGCGACGGCGCTGGCGGAGCGGCTG
GAGGCCCGCGGGAAGCAGTTCAAGGAAGGAGCCTGAAGAGCTACGAGGATCTCGATCAGGTCTCGGGAGGTGGCG
ACGGGGAGCTCAATTACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail