Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4935
Gene name
LocationContig_35:105335..106203
Strand-
Gene length (bp)868
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07524 Bromo_TP Bromodomain associated 4.7E-06 7 59

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Bromodomain transcription factor

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4935
MPGHPLFYQDLLRPVVLQILRAAGYHATRLGVVDWLTELMGRYMSRVCQQTAMHALHNHGDDLLLDGLEVDMSAV
RAALDDMGALLPRSTGASGGEGEGGGVEEFVRWFEGGRNRDLMEAARDGDSDATDYLMALKRKHDKSADENRYHG
TLLGRPLDSPCDVFAPGGPDASINDWMDKRSRACFETSPRGPAPNGHPSPSASSGLGSVDRAVTAAAAAAVVETA
EAGGHVHLMDSS*
Coding >OphauB2|4935
ATGCCAGGCCACCCCCTCTTCTACCAAGACCTCCTGCGCCCTGTTGTTCTACAAATCCTCCGGGCGGCAGGCTAC
CACGCGACGCGTCTAGGGGTGGTGGACTGGCTGACGGAGCTCATGGGGCGGTACATGAGCCGCGTGTGCCAGCAG
ACGGCGATGCACGCGCTTCACAACCACGGGGACGACTTGTTGCTGGATGGGCTAGAGGTGGACATGAGTGCGGTG
CGGGCGGCGCTGGATGACATGGGGGCGCTGCTGCCGCGGAGTACAGGGGCGAGTGGTGGAGAGGGGGAGGGTGGT
GGCGTGGAGGAGTTTGTGAGGTGGTTTGAAGGTGGGAGGAATAGGGATTTGATGGAGGCGGCGAGGGATGGGGAT
TCTGATGCGACGGATTATCTCATGGCCCTCAAGAGAAAACACGACAAGTCGGCCGACGAAAACAGATACCACGGC
ACCCTCCTCGGCCGCCCCCTCGACTCTCCCTGCGACGTGTTTGCGCCCGGCGGCCCCGACGCCTCCATCAATGAC
TGGATGGATAAACGCTCCCGCGCCTGCTTCGAAACGAGCCCCCGCGGCCCCGCGCCCAACGGCCATCCCTCCCCG
TCGGCTAGCTCGGGTCTCGGCTCCGTGGACCGTGCTGTGACGGCGGCGGCGGCGGCGGCGGTGGTGGAAACAGCC
GAGGCGGGCGGCCATGTGCATCTGATGGATTCGTCGTAG
Transcript >OphauB2|4935
ATGCCAGGCCACCCCCTCTTCTACCAAGACCTCCTGCGCCCTGTTGTTCTACAAATCCTCCGGGCGGCAGGCTAC
CACGCGACGCGTCTAGGGGTGGTGGACTGGCTGACGGAGCTCATGGGGCGGTACATGAGCCGCGTGTGCCAGCAG
ACGGCGATGCACGCGCTTCACAACCACGGGGACGACTTGTTGCTGGATGGGCTAGAGGTGGACATGAGTGCGGTG
CGGGCGGCGCTGGATGACATGGGGGCGCTGCTGCCGCGGAGTACAGGGGCGAGTGGTGGAGAGGGGGAGGGTGGT
GGCGTGGAGGAGTTTGTGAGGTGGTTTGAAGGTGGGAGGAATAGGGATTTGATGGAGGCGGCGAGGGATGGGGAT
TCTGATGCGACGGATTATCTCATGGCCCTCAAGAGAAAACACGACAAGTCGGCCGACGAAAACAGATACCACGGC
ACCCTCCTCGGCCGCCCCCTCGACTCTCCCTGCGACGTGTTTGCGCCCGGCGGCCCCGACGCCTCCATCAATGAC
TGGATGGATAAACGCTCCCGCGCCTGCTTCGAAACGAGCCCCCGCGGCCCCGCGCCCAACGGCCATCCCTCCCCG
TCGGCTAGCTCGGGTCTCGGCTCCGTGGACCGTGCTGTGACGGCGGCGGCGGCGGCGGCGGTGGTGGAAACAGCC
GAGGCGGGCGGCCATGTGCATCTGATGGATTCGTCGTAG
Gene >OphauB2|4935
ATGCCAGGCCACCCCCTCTTCTACCAAGACCTCCTGCGCCCTGTTGTTCTACAAATCCTCCGGGCGGCAGGCTAC
CACGCGACGCGTCTAGGGGTGGTGGACTGGCTGACGGAGCTCATGGGGCGGTACATGAGCCGCGTGTGCCAGCAG
ACGGCGATGCACGCGCTTCACAACCACGGGGACGACTTGTTGCTGGATGGGCTAGAGGTGGACATGAGTGCGGTG
CGGGCGGCGCTGGATGACATGGGGGCGCTGCTGCCGCGGAGTACAGGGGCGAGTGGTGGAGAGGGGGAGGGTGGT
GGCGTGGAGGAGTTTGTGAGGTGGTTTGAAGGTGGGAGGAATAGGGATTTGATGGAGGCGGCGAGGGATGGGGAT
TCTGATGCGACGGATTATCTCATGGGTCAGTTTTTTTTTCTTTTTTTTTTTTTGTCTTGTCGATTTGGGAGACGG
GATGCTCTCTAGGCTCCTCCGTCTTTGTTCTTTGCTCTTGGTTTGGGAGGCGTGATGCTTCCCATTTCTCGCTCT
GATATCGACTTGGCGCTGACCACGCCCAGCCCTCAAGAGAAAACACGACAAGTCGGCCGACGAAAACAGATACCA
CGGCACCCTCCTCGGCCGCCCCCTCGACTCTCCCTGCGACGTGTTTGCGCCCGGCGGCCCCGACGCCTCCATCAA
TGACTGGATGGATAAACGCTCCCGCGCCTGCTTCGAAACGAGCCCCCGCGGCCCCGCGCCCAACGGCCATCCCTC
CCCGTCGGCTAGCTCGGGTCTCGGCTCCGTGGACCGTGCTGTGACGGCGGCGGCGGCGGCGGCGGTGGTGGAAAC
AGCCGAGGCGGGCGGCCATGTGCATCTGATGGATTCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail