Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4932
Gene name
LocationContig_35:99735..100841
Strand+
Gene length (bp)1106
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08508 DUF1746 Fungal domain of unknown function (DUF1746) 5.9E-32 70 172

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14175|DSC4_SCHPO DSC E3 ubiquitin ligase complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc4 PE=1 SV=1 66 218 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 115 137 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4932
MNRDVSHHEAERIDDDGATSDNVPEGANSGSSSNLQPHTRHRRKRKIKRKRRRPGLVKKLEFTTHLLQTLDLVVF
AELSALYYMECSMFRFLLRALSQVLYLTPKHESFPFHTPAGRILTLLIVMPNIVCLLLHLFGSLPTGPEFHRGYQ
HGGVVIDFIGQKPATYRLYYLLRERLRLRLNTFRPLLPALALEIPRMRSSEDLDAEERGILQADTLDETESIELQ
SLHFSRRGVSSPELAESSRTDQMPESNVSAASLLDILTSGNAVLGEYHIVQSLSSAAMDLDRAAAQSLRTISYGA
TMAALRAQQRGTLTQSRPQPNTEQAN*
Coding >OphauB2|4932
ATGAACCGCGATGTATCGCACCATGAGGCGGAAAGAATCGATGACGATGGAGCAACCTCGGACAATGTGCCCGAG
GGGGCAAACTCGGGCTCGTCTTCAAATTTGCAGCCCCATACCAGGCATCGGCGCAAGAGGAAGATCAAGAGAAAG
AGGCGCCGGCCAGGACTCGTCAAGAAGCTCGAGTTTACTACCCATCTGCTTCAGACGCTCGATCTCGTCGTCTTT
GCCGAACTGAGTGCTCTCTACTACATGGAGTGCTCCATGTTTCGATTTCTACTCCGCGCTCTCAGTCAGGTTCTA
TACCTGACACCCAAACACGAGAGCTTTCCTTTTCATACACCGGCCGGTCGGATCCTTACGCTTCTGATCGTCATG
CCTAATATTGTCTGCCTGCTCCTTCATCTCTTTGGTTCGCTGCCCACCGGACCCGAATTTCATCGCGGCTACCAG
CATGGAGGAGTTGTCATCGACTTTATCGGGCAGAAGCCTGCCACGTACAGGCTCTACTATTTGCTACGGGAAAGG
TTGCGCCTCAGACTAAACACTTTTCGTCCCTTGCTCCCCGCTCTTGCGCTCGAGATACCACGGATGCGGTCATCA
GAAGACCTAGACGCAGAGGAGCGAGGCATTCTGCAAGCCGACACTCTGGATGAGACCGAGTCTATCGAGCTACAA
TCTCTGCATTTCTCGCGGAGAGGCGTGTCAAGCCCTGAGCTTGCAGAGAGCTCTCGCACTGACCAGATGCCAGAG
AGCAATGTGTCAGCAGCAAGTCTCCTGGATATTCTTACCTCGGGGAATGCTGTTCTGGGCGAATATCACATCGTG
CAGTCTCTGTCATCGGCGGCTATGGATCTGGATCGAGCGGCAGCTCAATCTCTTCGCACTATTAGCTATGGAGCC
ACCATGGCGGCTCTTCGAGCTCAACAGCGAGGCACGCTTACACAATCCCGTCCTCAGCCCAATACAGAGCAAGCA
AATTGA
Transcript >OphauB2|4932
ATGAACCGCGATGTATCGCACCATGAGGCGGAAAGAATCGATGACGATGGAGCAACCTCGGACAATGTGCCCGAG
GGGGCAAACTCGGGCTCGTCTTCAAATTTGCAGCCCCATACCAGGCATCGGCGCAAGAGGAAGATCAAGAGAAAG
AGGCGCCGGCCAGGACTCGTCAAGAAGCTCGAGTTTACTACCCATCTGCTTCAGACGCTCGATCTCGTCGTCTTT
GCCGAACTGAGTGCTCTCTACTACATGGAGTGCTCCATGTTTCGATTTCTACTCCGCGCTCTCAGTCAGGTTCTA
TACCTGACACCCAAACACGAGAGCTTTCCTTTTCATACACCGGCCGGTCGGATCCTTACGCTTCTGATCGTCATG
CCTAATATTGTCTGCCTGCTCCTTCATCTCTTTGGTTCGCTGCCCACCGGACCCGAATTTCATCGCGGCTACCAG
CATGGAGGAGTTGTCATCGACTTTATCGGGCAGAAGCCTGCCACGTACAGGCTCTACTATTTGCTACGGGAAAGG
TTGCGCCTCAGACTAAACACTTTTCGTCCCTTGCTCCCCGCTCTTGCGCTCGAGATACCACGGATGCGGTCATCA
GAAGACCTAGACGCAGAGGAGCGAGGCATTCTGCAAGCCGACACTCTGGATGAGACCGAGTCTATCGAGCTACAA
TCTCTGCATTTCTCGCGGAGAGGCGTGTCAAGCCCTGAGCTTGCAGAGAGCTCTCGCACTGACCAGATGCCAGAG
AGCAATGTGTCAGCAGCAAGTCTCCTGGATATTCTTACCTCGGGGAATGCTGTTCTGGGCGAATATCACATCGTG
CAGTCTCTGTCATCGGCGGCTATGGATCTGGATCGAGCGGCAGCTCAATCTCTTCGCACTATTAGCTATGGAGCC
ACCATGGCGGCTCTTCGAGCTCAACAGCGAGGCACGCTTACACAATCCCGTCCTCAGCCCAATACAGAGCAAGCA
AATTGA
Gene >OphauB2|4932
ATGAACCGCGATGTATCGCACCATGAGGCGGAAAGAATCGATGACGATGGAGCAACCTCGGACAATGTGCCCGAG
GGGGCAAACTCGGGCTCGTCTTCAAATTTGCAGCCCCATACCAGGCATCGGCGCAAGAGGAAGATCAAGAGAAAG
AGGCGCCGGCCAGGACTCGTCAAGAAGCTCGAGTTTACTACCCATCTGCTTCAGACGCTCGATCTCGTCGTCTTT
GCCGAACTGAGTGCTCTCTACTACATGGAGTATGTAGACTCCACCACCACGTGCAAGCCACAAAAGAATTGTTAT
ATTCTGACACTGTGTCGTTTTTTAGGTGCTCCATGTTTCGATTTCTACTCCGCGCTCTCAGTCAGGTTCTATACC
TGACACCCAAACACGAGAGCTTTCCTTTTCATACACCGGCCGGTCGGATCCTTACGCTTCTGATCGTCATGCCTA
ATATTGTCTGCCTGCTCCTTCATCTCTTTGGTTCGCTGCCCACCGGACCCGAATTTCATCGCGGCTACCAGCATG
GAGGAGTTGTCATCGACTTTATCGGGCAGAAGCCTGCCACGTACAGGCTCTACTATTTGCTAGTAGATGTCGTCA
TACTTGTCCTACAATGCTTGATGCTTACAGTGCATACACAGCGGGAAAGGTTGCGCCTCAGACTAAACACTTTTC
GTCCCTTGCTCCCCGCTCTTGCGCTCGAGATACCACGGATGCGGTCATCAGAAGACCTAGACGCAGAGGAGCGAG
GCATTCTGCAAGCCGACACTCTGGATGAGACCGAGTCTATCGAGCTACAATCTCTGCATTTCTCGCGGAGAGGCG
TGTCAAGCCCTGAGCTTGCAGAGAGCTCTCGCACTGACCAGATGCCAGAGAGCAATGTGTCAGCAGCAAGTCTCC
TGGATATTCTTACCTCGGGGAATGCTGTTCTGGGCGAATATCACATCGTGCAGTCTCTGTCATCGGCGGCTATGG
ATCTGGATCGAGCGGCAGCTCAATCTCTTCGCACTATTAGCTATGGAGCCACCATGGCGGCTCTTCGAGCTCAAC
AGCGAGGCACGCTTACACAATCCCGTCCTCAGCCCAATACAGAGCAAGCAAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail