Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4931
Gene name
LocationContig_35:97695..99295
Strand-
Gene length (bp)1600
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F) 2.8E-85 212 502
PF18553 PheRS_DBD3 PheRS DNA binding domain 3 5.0E-16 77 136
PF18554 PheRS_DBD2 PheRS DNA binding domain 2 4.8E-06 138 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15625|SYFA_YEAST Phenylalanine--tRNA ligase alpha subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS2 PE=1 SV=3 10 512 0.0E+00
sp|O42870|SYFA_SCHPO Phenylalanine--tRNA ligase alpha subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs2 PE=3 SV=3 38 512 1.0E-180
sp|Q7SYV0|SYFAB_XENLA Phenylalanine--tRNA ligase alpha subunit B OS=Xenopus laevis GN=farsa-b PE=2 SV=1 31 510 4.0E-164
sp|Q6AZG6|SYFAA_XENLA Phenylalanine--tRNA ligase alpha subunit A OS=Xenopus laevis GN=farsa-a PE=2 SV=1 31 510 2.0E-163
sp|Q1JPX3|SYFA_DANRE Phenylalanine--tRNA ligase alpha subunit OS=Danio rerio GN=farsa PE=2 SV=2 27 510 5.0E-159
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15625|SYFA_YEAST Phenylalanine--tRNA ligase alpha subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS2 PE=1 SV=3 10 512 0.0E+00
sp|O42870|SYFA_SCHPO Phenylalanine--tRNA ligase alpha subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs2 PE=3 SV=3 38 512 1.0E-180
sp|Q7SYV0|SYFAB_XENLA Phenylalanine--tRNA ligase alpha subunit B OS=Xenopus laevis GN=farsa-b PE=2 SV=1 31 510 4.0E-164
sp|Q6AZG6|SYFAA_XENLA Phenylalanine--tRNA ligase alpha subunit A OS=Xenopus laevis GN=farsa-a PE=2 SV=1 31 510 2.0E-163
sp|Q1JPX3|SYFA_DANRE Phenylalanine--tRNA ligase alpha subunit OS=Danio rerio GN=farsa PE=2 SV=2 27 510 5.0E-159
sp|Q505J8|SYFA_RAT Phenylalanine--tRNA ligase alpha subunit OS=Rattus norvegicus GN=Farsa PE=1 SV=1 35 512 8.0E-159
sp|Q8C0C7|SYFA_MOUSE Phenylalanine--tRNA ligase alpha subunit OS=Mus musculus GN=Farsa PE=1 SV=1 35 512 5.0E-157
sp|Q5RFA2|SYFA_PONAB Phenylalanine--tRNA ligase alpha subunit OS=Pongo abelii GN=FARSA PE=2 SV=1 7 512 3.0E-154
sp|Q9Y285|SYFA_HUMAN Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens GN=FARSA PE=1 SV=3 65 512 4.0E-154
sp|Q9W3J5|SYFA_DROME Phenylalanine--tRNA ligase alpha subunit OS=Drosophila melanogaster GN=alpha-PheRS PE=1 SV=1 11 511 3.0E-152
sp|Q9T034|SYFA_ARATH Phenylalanine--tRNA ligase alpha subunit, cytoplasmic OS=Arabidopsis thaliana GN=At4g39280 PE=2 SV=3 16 508 6.0E-149
sp|Q8SRG9|SYFA_ENCCU Probable phenylalanine--tRNA ligase alpha subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_1660 PE=3 SV=1 12 510 1.0E-146
sp|Q54KS8|SYFA_DICDI Phenylalanine--tRNA ligase alpha subunit OS=Dictyostelium discoideum GN=phesA PE=3 SV=1 37 512 1.0E-139
sp|C4V6K5|SYFA_NOSCE Probable phenylalanine--tRNA ligase alpha subunit OS=Nosema ceranae (strain BRL01) GN=NCER_100038 PE=3 SV=1 12 509 9.0E-136
sp|Q5ZJQ2|SYFA_CHICK Phenylalanine--tRNA ligase alpha subunit OS=Gallus gallus GN=FARSA PE=1 SV=1 4 453 6.0E-124
sp|B7XI98|SYFA_ENTBH Probable phenylalanine--tRNA ligase alpha subunit OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22775 PE=3 SV=1 16 507 6.0E-119
sp|O28324|SYFA_ARCFU Phenylalanine--tRNA ligase alpha subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pheS PE=3 SV=1 12 508 6.0E-79
sp|Q0W0X9|SYFA_METAR Phenylalanine--tRNA ligase alpha subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pheS PE=3 SV=1 36 507 7.0E-78
sp|Q57911|SYFA_METJA Phenylalanine--tRNA ligase alpha subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pheS PE=3 SV=1 67 503 2.0E-74
sp|Q8TYM5|SYFA_METKA Phenylalanine--tRNA ligase alpha subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pheS PE=3 SV=1 192 491 6.0E-73
sp|A2ST81|SYFA_METLZ Phenylalanine--tRNA ligase alpha subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pheS PE=3 SV=1 47 508 6.0E-72
sp|Q979U4|SYFA_THEVO Phenylalanine--tRNA ligase alpha subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pheS PE=3 SV=1 38 502 6.0E-71
sp|Q6LX56|SYFA_METMP Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=pheS PE=3 SV=1 76 503 3.0E-70
sp|P57693|SYFA_THEAC Phenylalanine--tRNA ligase alpha subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pheS PE=3 SV=1 15 501 8.0E-70
sp|Q9HMK4|SYFA_HALSA Phenylalanine--tRNA ligase alpha subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pheS PE=3 SV=1 184 509 9.0E-70
sp|B0R806|SYFA_HALS3 Phenylalanine--tRNA ligase alpha subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pheS PE=3 SV=1 184 509 9.0E-70
sp|A3CT76|SYFA_METMJ Phenylalanine--tRNA ligase alpha subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pheS PE=3 SV=1 107 506 2.0E-68
sp|A6VH81|SYFA_METM7 Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pheS PE=3 SV=1 90 503 5.0E-68
sp|O26837|SYFA_METTH Phenylalanine--tRNA ligase alpha subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pheS PE=1 SV=1 15 506 5.0E-68
sp|Q8PWV6|SYFA_METMA Phenylalanine--tRNA ligase alpha subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pheS PE=3 SV=1 65 497 1.0E-67
sp|A6UQD9|SYFA_METVS Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pheS PE=3 SV=1 15 507 5.0E-67
sp|Q46CQ6|SYFA_METBF Phenylalanine--tRNA ligase alpha subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pheS PE=3 SV=1 154 508 5.0E-65
sp|A4FW27|SYFA_METM5 Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pheS PE=3 SV=1 154 503 5.0E-65
sp|Q2FLL0|SYFA_METHJ Phenylalanine--tRNA ligase alpha subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pheS PE=3 SV=1 102 508 1.0E-64
sp|Q8TUA2|SYFA_METAC Phenylalanine--tRNA ligase alpha subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pheS PE=3 SV=1 53 509 2.0E-64
sp|B6YTJ4|SYFA_THEON Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus onnurineus (strain NA1) GN=pheS PE=3 SV=1 73 501 2.0E-63
sp|Q9UYX3|SYFA_PYRAB Phenylalanine--tRNA ligase alpha subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pheS PE=3 SV=1 150 494 2.0E-63
sp|O58391|SYFA_PYRHO Phenylalanine--tRNA ligase alpha subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pheS PE=3 SV=1 76 507 1.0E-62
sp|Q8U261|SYFA_PYRFU Phenylalanine--tRNA ligase alpha subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pheS PE=3 SV=1 158 494 1.0E-62
sp|Q76KA8|SYFA_THEKO Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pheS PE=1 SV=1 73 494 3.0E-60
sp|C5A5Y9|SYFA_THEGJ Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pheS PE=3 SV=1 73 494 5.0E-58
sp|A4YIL1|SYFA_METS5 Phenylalanine--tRNA ligase alpha subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pheS PE=3 SV=1 35 501 3.0E-57
sp|P95961|SYFA_SULSO Phenylalanine--tRNA ligase alpha subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pheS PE=3 SV=2 125 497 4.0E-56
sp|A3MUA4|SYFA_PYRCJ Phenylalanine--tRNA ligase alpha subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pheS PE=3 SV=1 41 497 2.0E-55
sp|C6A236|SYFA_THESM Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pheS PE=3 SV=1 184 494 4.0E-55
sp|Q9Y9I6|SYFA_AERPE Phenylalanine--tRNA ligase alpha subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pheS PE=3 SV=2 94 497 7.0E-55
sp|P94282|SYFA_BORBU Phenylalanine--tRNA ligase alpha subunit OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pheS PE=3 SV=2 190 496 5.0E-53
sp|Q8ZX61|SYFA_PYRAE Phenylalanine--tRNA ligase alpha subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pheS PE=3 SV=1 96 492 9.0E-53
sp|Q971D7|SYFA_SULTO Phenylalanine--tRNA ligase alpha subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pheS PE=3 SV=1 157 497 5.0E-52
sp|Q4J8P9|SYFA_SULAC Phenylalanine--tRNA ligase alpha subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pheS PE=3 SV=1 152 498 2.0E-50
sp|A4WHY5|SYFA_PYRAR Phenylalanine--tRNA ligase alpha subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pheS PE=3 SV=1 191 492 2.0E-50
sp|B2S4L0|SYFA_TREPS Phenylalanine--tRNA ligase alpha subunit OS=Treponema pallidum subsp. pallidum (strain SS14) GN=pheS PE=3 SV=1 194 497 2.0E-45
sp|O83938|SYFA_TREPA Phenylalanine--tRNA ligase alpha subunit OS=Treponema pallidum (strain Nichols) GN=pheS PE=3 SV=1 194 497 2.0E-45
sp|Q5M3S5|SYFA_STRT2 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pheS PE=3 SV=2 218 489 2.0E-35
sp|Q5LZ70|SYFA_STRT1 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pheS PE=3 SV=2 218 489 2.0E-35
sp|Q03K19|SYFA_STRTD Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=pheS PE=3 SV=1 218 489 3.0E-35
sp|Q8CWX1|SYFA_STRMU Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pheS PE=3 SV=1 218 489 4.0E-34
sp|Q72HA1|SYFA_THET2 Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pheS PE=3 SV=1 218 507 8.0E-34
sp|Q836J6|SYFA_ENTFA Phenylalanine--tRNA ligase alpha subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pheS PE=3 SV=1 218 503 1.0E-33
sp|Q11Q26|SYFA_CYTH3 Phenylalanine--tRNA ligase alpha subunit OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pheS PE=3 SV=1 95 489 3.0E-33
sp|Q9CEB4|SYFA_LACLA Phenylalanine--tRNA ligase alpha subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pheS PE=3 SV=1 218 503 5.0E-33
sp|P27001|SYFA_THETH Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus GN=pheS PE=1 SV=1 218 507 9.0E-33
sp|Q5SGX2|SYFA_THET8 Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pheS PE=1 SV=1 218 507 9.0E-33
sp|A8ZZ70|SYFA_DESOH Phenylalanine--tRNA ligase alpha subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=pheS PE=3 SV=1 224 492 1.0E-32
sp|Q02WL3|SYFA_LACLS Phenylalanine--tRNA ligase alpha subunit OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=pheS PE=3 SV=1 218 503 1.0E-32
sp|A2RN75|SYFA_LACLM Phenylalanine--tRNA ligase alpha subunit OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pheS PE=3 SV=1 218 503 2.0E-32
sp|A4XKJ8|SYFA_CALS8 Phenylalanine--tRNA ligase alpha subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pheS PE=3 SV=1 218 503 2.0E-32
sp|Q2SSA0|SYFA_MYCCT Phenylalanine--tRNA ligase alpha subunit OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pheS PE=3 SV=1 95 496 2.0E-32
sp|C0MH11|SYFA_STRS7 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pheS PE=3 SV=1 218 489 2.0E-32
sp|C0M7G8|SYFA_STRE4 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus equi subsp. equi (strain 4047) GN=pheS PE=3 SV=1 218 489 2.0E-32
sp|B4U2E8|SYFA_STREM Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=pheS PE=3 SV=1 218 489 2.0E-32
sp|A6TNP8|SYFA_ALKMQ Phenylalanine--tRNA ligase alpha subunit OS=Alkaliphilus metalliredigens (strain QYMF) GN=pheS PE=3 SV=1 218 503 3.0E-32
sp|B9MRS9|SYFA_CALBD Phenylalanine--tRNA ligase alpha subunit OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pheS PE=3 SV=1 218 503 3.0E-32
sp|Q9A0I1|SYFA_STRP1 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M1 GN=pheS PE=3 SV=2 218 489 4.0E-32
sp|B9DRU2|SYFA_STRU0 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=pheS PE=3 SV=1 218 489 4.0E-32
sp|B5XKQ6|SYFA_STRPZ Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=pheS PE=3 SV=1 218 489 5.0E-32
sp|P0DG51|SYFA_STRPQ Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pheS PE=3 SV=1 218 489 5.0E-32
sp|Q5XCX4|SYFA_STRP6 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pheS PE=3 SV=2 218 489 5.0E-32
sp|P0DG50|SYFA_STRP3 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pheS PE=3 SV=1 218 489 5.0E-32
sp|A4YJN0|SYFA_BRASO Phenylalanine--tRNA ligase alpha subunit OS=Bradyrhizobium sp. (strain ORS278) GN=pheS PE=3 SV=1 222 492 5.0E-32
sp|Q8E066|SYFA_STRA5 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pheS PE=3 SV=1 218 489 5.0E-32
sp|Q3K1I9|SYFA_STRA1 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pheS PE=3 SV=1 218 489 5.0E-32
sp|Q8E5U3|SYFA_STRA3 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pheS PE=3 SV=1 218 489 7.0E-32
sp|B3Q5X1|SYFA_RHOPT Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain TIE-1) GN=pheS PE=3 SV=1 224 492 7.0E-32
sp|Q6NDR7|SYFA_RHOPA Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pheS PE=3 SV=1 224 492 7.0E-32
sp|Q2LR28|SYFA_SYNAS Phenylalanine--tRNA ligase alpha subunit OS=Syntrophus aciditrophicus (strain SB) GN=pheS PE=3 SV=1 218 489 7.0E-32
sp|A0L4K0|SYFA_MAGMM Phenylalanine--tRNA ligase alpha subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=pheS PE=3 SV=1 218 504 7.0E-32
sp|Q73IM5|SYFA_WOLPM Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia pipientis wMel GN=pheS PE=3 SV=1 130 496 8.0E-32
sp|Q7VAV9|SYFA_PROMA Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=pheS PE=3 SV=1 224 503 8.0E-32
sp|A9BFH2|SYFA_PETMO Phenylalanine--tRNA ligase alpha subunit OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=pheS PE=3 SV=1 218 504 1.0E-31
sp|C0R5D1|SYFA_WOLWR Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=pheS PE=3 SV=1 224 496 1.0E-31
sp|Q7TTU6|SYFA_SYNPX Phenylalanine--tRNA ligase alpha subunit OS=Synechococcus sp. (strain WH8102) GN=pheS PE=3 SV=1 224 503 1.0E-31
sp|Q8R9C6|SYFA_CALS4 Phenylalanine--tRNA ligase alpha subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pheS PE=3 SV=1 210 503 1.0E-31
sp|Q7TV42|SYFA_PROMM Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain MIT 9313) GN=pheS PE=3 SV=1 223 503 1.0E-31
sp|A0LFC6|SYFA_SYNFM Phenylalanine--tRNA ligase alpha subunit OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pheS PE=3 SV=1 224 489 2.0E-31
sp|A6WX16|SYFA_OCHA4 Phenylalanine--tRNA ligase alpha subunit OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pheS PE=3 SV=1 224 502 2.0E-31
sp|Q8FXX5|SYFA_BRUSU Phenylalanine--tRNA ligase alpha subunit OS=Brucella suis biovar 1 (strain 1330) GN=pheS PE=3 SV=1 224 502 2.0E-31
sp|B0CJX0|SYFA_BRUSI Phenylalanine--tRNA ligase alpha subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pheS PE=3 SV=1 224 502 2.0E-31
sp|C0RG06|SYFA_BRUMB Phenylalanine--tRNA ligase alpha subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pheS PE=3 SV=1 224 502 2.0E-31
sp|Q57AE0|SYFA_BRUAB Phenylalanine--tRNA ligase alpha subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=pheS PE=3 SV=1 224 502 2.0E-31
sp|Q2YQV5|SYFA_BRUA2 Phenylalanine--tRNA ligase alpha subunit OS=Brucella abortus (strain 2308) GN=pheS PE=3 SV=1 224 502 2.0E-31
sp|B2S9B8|SYFA_BRUA1 Phenylalanine--tRNA ligase alpha subunit OS=Brucella abortus (strain S19) GN=pheS PE=3 SV=1 224 502 2.0E-31
sp|Q319M1|SYFA_PROM9 Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain MIT 9312) GN=pheS PE=3 SV=1 224 503 3.0E-31
sp|A5E8L7|SYFA_BRASB Phenylalanine--tRNA ligase alpha subunit OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pheS PE=3 SV=1 224 492 3.0E-31
sp|Q89WI1|SYFA_BRADU Phenylalanine--tRNA ligase alpha subunit OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pheS PE=3 SV=1 219 496 4.0E-31
sp|Q21C64|SYFA_RHOPB Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain BisB18) GN=pheS PE=3 SV=1 224 492 4.0E-31
sp|A9VJM4|SYFA_BACWK Phenylalanine--tRNA ligase alpha subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=pheS PE=3 SV=1 224 496 4.0E-31
sp|Q67QF3|SYFA_SYMTH Phenylalanine--tRNA ligase alpha subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pheS PE=3 SV=1 218 501 5.0E-31
sp|A5VT73|SYFA_BRUO2 Phenylalanine--tRNA ligase alpha subunit OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pheS PE=3 SV=1 224 502 5.0E-31
sp|B6IZG0|SYFA_COXB2 Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain CbuG_Q212) GN=pheS PE=3 SV=1 218 501 5.0E-31
sp|Q83C14|SYFA_COXBU Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pheS PE=3 SV=1 218 501 6.0E-31
sp|A9N8K1|SYFA_COXBR Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pheS PE=3 SV=1 218 501 6.0E-31
sp|A9KGB7|SYFA_COXBN Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pheS PE=3 SV=1 218 501 6.0E-31
sp|Q8YE73|SYFA_BRUME Phenylalanine--tRNA ligase alpha subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pheS PE=3 SV=1 224 502 6.0E-31
sp|B0TEV9|SYFA_HELMI Phenylalanine--tRNA ligase alpha subunit OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=pheS PE=3 SV=1 218 501 6.0E-31
sp|B6J7X7|SYFA_COXB1 Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain CbuK_Q154) GN=pheS PE=3 SV=1 218 501 6.0E-31
sp|Q1QS22|SYFA_NITHX Phenylalanine--tRNA ligase alpha subunit OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pheS PE=3 SV=1 223 492 6.0E-31
sp|Q8P1K1|SYFA_STRP8 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pheS PE=3 SV=2 218 489 6.0E-31
sp|C3PNE3|SYFA_RICAE Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia africae (strain ESF-5) GN=pheS PE=3 SV=1 224 492 7.0E-31
sp|Q6HCW7|SYFA_BACHK Phenylalanine--tRNA ligase alpha subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|Q633N4|SYFA_BACCZ Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain ZK / E33L) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|Q817I6|SYFA_BACCR Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|B9J063|SYFA_BACCQ Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain Q1) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|B7HRK2|SYFA_BACC7 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain AH187) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|C1EU00|SYFA_BACC3 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain 03BB102) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|Q72ZI1|SYFA_BACC1 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|B7JR67|SYFA_BACC0 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain AH820) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|Q81L30|SYFA_BACAN Phenylalanine--tRNA ligase alpha subunit OS=Bacillus anthracis GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|C3L8T8|SYFA_BACAC Phenylalanine--tRNA ligase alpha subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|C3PAE9|SYFA_BACAA Phenylalanine--tRNA ligase alpha subunit OS=Bacillus anthracis (strain A0248) GN=pheS PE=3 SV=1 224 496 9.0E-31
sp|A7GTL0|SYFA_BACCN Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pheS PE=3 SV=1 223 496 1.0E-30
sp|B7HF77|SYFA_BACC4 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain B4264) GN=pheS PE=3 SV=1 224 496 1.0E-30
sp|B7IJW0|SYFA_BACC2 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain G9842) GN=pheS PE=3 SV=1 224 496 1.0E-30
sp|A8FG17|SYFA_BACP2 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus pumilus (strain SAFR-032) GN=pheS PE=3 SV=1 224 496 1.0E-30
sp|Q5NMC2|SYFA_ZYMMO Phenylalanine--tRNA ligase alpha subunit OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pheS PE=3 SV=1 224 489 1.0E-30
sp|A8MI78|SYFA_ALKOO Phenylalanine--tRNA ligase alpha subunit OS=Alkaliphilus oremlandii (strain OhILAs) GN=pheS PE=3 SV=1 224 503 1.0E-30
sp|B3EKG5|SYFA_CHLPB Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium phaeobacteroides (strain BS1) GN=pheS PE=3 SV=1 176 496 2.0E-30
sp|A4IRM4|SYFA_GEOTN Phenylalanine--tRNA ligase alpha subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pheS PE=3 SV=1 134 503 2.0E-30
sp|A7HLU6|SYFA_FERNB Phenylalanine--tRNA ligase alpha subunit OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pheS PE=3 SV=1 218 502 2.0E-30
sp|B6JCK5|SYFA_OLICO Phenylalanine--tRNA ligase alpha subunit OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pheS PE=3 SV=1 224 492 2.0E-30
sp|Q2SVE2|SYFA_BURTA Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pheS PE=3 SV=1 218 501 2.0E-30
sp|Q46JK1|SYFA_PROMT Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain NATL2A) GN=pheS PE=3 SV=1 224 503 2.0E-30
sp|C1CCV6|SYFA_STRZJ Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain JJA) GN=pheS PE=3 SV=1 223 489 2.0E-30
sp|B1I4I5|SYFA_DESAP Phenylalanine--tRNA ligase alpha subunit OS=Desulforudis audaxviator (strain MP104C) GN=pheS PE=3 SV=1 218 501 2.0E-30
sp|Q63TM6|SYFA_BURPS Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia pseudomallei (strain K96243) GN=pheS PE=3 SV=1 218 501 3.0E-30
sp|Q3JT08|SYFA_BURP1 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia pseudomallei (strain 1710b) GN=pheS PE=3 SV=1 218 501 3.0E-30
sp|Q62KI6|SYFA_BURMA Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia mallei (strain ATCC 23344) GN=pheS PE=3 SV=1 218 501 3.0E-30
sp|A3MJU2|SYFA_BURM7 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia mallei (strain NCTC 10247) GN=pheS PE=3 SV=1 218 501 3.0E-30
sp|C4K2A1|SYFA_RICPU Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia peacockii (strain Rustic) GN=pheS PE=3 SV=1 224 492 3.0E-30
sp|Q92I39|SYFA_RICCN Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=pheS PE=3 SV=1 224 492 3.0E-30
sp|Q4ULS5|SYFA_RICFE Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pheS PE=3 SV=2 224 492 3.0E-30
sp|Q4L5E3|SYFA_STAHJ Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pheS PE=1 SV=1 224 507 3.0E-30
sp|A3DBX6|SYFA_CLOTH Phenylalanine--tRNA ligase alpha subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=pheS PE=3 SV=1 218 503 3.0E-30
sp|A8GS12|SYFA_RICRS Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia rickettsii (strain Sheila Smith) GN=pheS PE=3 SV=1 224 492 3.0E-30
sp|B2SZF8|SYFA_BURPP Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=pheS PE=3 SV=1 218 503 3.0E-30
sp|Q6ANC1|SYFA_DESPS Phenylalanine--tRNA ligase alpha subunit OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pheS PE=3 SV=1 218 489 4.0E-30
sp|A5N254|SYFA_CLOK5 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pheS PE=3 SV=1 218 501 4.0E-30
sp|C5D627|SYFA_GEOSW Phenylalanine--tRNA ligase alpha subunit OS=Geobacillus sp. (strain WCH70) GN=pheS PE=3 SV=1 224 503 4.0E-30
sp|B8ESQ6|SYFA_METSB Phenylalanine--tRNA ligase alpha subunit OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=pheS PE=3 SV=1 223 489 4.0E-30
sp|A4JDU8|SYFA_BURVG Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pheS PE=3 SV=1 218 501 4.0E-30
sp|Q1RIS9|SYFA_RICBR Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia bellii (strain RML369-C) GN=pheS PE=3 SV=1 224 492 4.0E-30
sp|A8GWH2|SYFA_RICB8 Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia bellii (strain OSU 85-389) GN=pheS PE=3 SV=1 224 492 4.0E-30
sp|Q55187|SYFA_SYNY3 Phenylalanine--tRNA ligase alpha subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pheS PE=3 SV=1 218 503 4.0E-30
sp|A8EZ06|SYFA_RICCK Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia canadensis (strain McKiel) GN=pheS PE=3 SV=1 224 492 4.0E-30
sp|Q3B6M2|SYFA_CHLL7 Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pheS PE=3 SV=1 218 506 5.0E-30
sp|A1UUA8|SYFA_BARBK Phenylalanine--tRNA ligase alpha subunit OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pheS PE=3 SV=1 79 489 6.0E-30
sp|B4E7I9|SYFA_BURCJ Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pheS PE=3 SV=1 218 501 6.0E-30
sp|A3NUI8|SYFA_BURP0 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia pseudomallei (strain 1106a) GN=pheS PE=3 SV=1 218 501 6.0E-30
sp|B3CMZ6|SYFA_WOLPP Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=pheS PE=3 SV=1 130 496 7.0E-30
sp|Q1GZS1|SYFA_METFK Phenylalanine--tRNA ligase alpha subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pheS PE=3 SV=1 221 503 7.0E-30
sp|P17921|SYFA_BACSU Phenylalanine--tRNA ligase alpha subunit OS=Bacillus subtilis (strain 168) GN=pheS PE=3 SV=2 223 496 7.0E-30
sp|B4S3C8|SYFA_PROA2 Phenylalanine--tRNA ligase alpha subunit OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=pheS PE=3 SV=1 224 496 7.0E-30
sp|B8G0L8|SYFA_DESHD Phenylalanine--tRNA ligase alpha subunit OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pheS PE=3 SV=1 218 503 8.0E-30
sp|Q0SRU1|SYFA_CLOPS Phenylalanine--tRNA ligase alpha subunit OS=Clostridium perfringens (strain SM101 / Type A) GN=pheS PE=3 SV=1 218 503 8.0E-30
sp|Q97S36|SYFA_STRPN Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pheS PE=3 SV=1 224 489 8.0E-30
sp|C1C5V0|SYFA_STRP7 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain 70585) GN=pheS PE=3 SV=1 224 489 8.0E-30
sp|Q8DQT8|SYFA_STRR6 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pheS PE=3 SV=2 224 489 8.0E-30
sp|B1IAA1|SYFA_STRPI Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pheS PE=3 SV=1 224 489 8.0E-30
sp|Q04LU1|SYFA_STRP2 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pheS PE=3 SV=1 224 489 8.0E-30
sp|Q5KWE4|SYFA_GEOKA Phenylalanine--tRNA ligase alpha subunit OS=Geobacillus kaustophilus (strain HTA426) GN=pheS PE=3 SV=1 218 501 8.0E-30
sp|Q0TP72|SYFA_CLOP1 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pheS PE=3 SV=1 218 503 8.0E-30
sp|Q39H51|SYFA_BURL3 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pheS PE=3 SV=1 218 503 8.0E-30
sp|Q7V0I7|SYFA_PROMP Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=pheS PE=3 SV=1 224 503 9.0E-30
sp|B9E766|SYFA_MACCJ Phenylalanine--tRNA ligase alpha subunit OS=Macrococcus caseolyticus (strain JCSC5402) GN=pheS PE=3 SV=1 218 501 9.0E-30
sp|Q8XJ75|SYFA_CLOPE Phenylalanine--tRNA ligase alpha subunit OS=Clostridium perfringens (strain 13 / Type A) GN=pheS PE=3 SV=1 218 503 1.0E-29
sp|B5EBY3|SYFA_GEOBB Phenylalanine--tRNA ligase alpha subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=pheS PE=3 SV=1 218 503 1.0E-29
sp|Q0VNG2|SYFA_ALCBS Phenylalanine--tRNA ligase alpha subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pheS PE=3 SV=1 134 489 1.0E-29
sp|B9DPU8|SYFA_STACT Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus carnosus (strain TM300) GN=pheS PE=3 SV=1 224 507 1.0E-29
sp|Q8EPH4|SYFA_OCEIH Phenylalanine--tRNA ligase alpha subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pheS PE=3 SV=1 218 489 1.0E-29
sp|A4J4Z4|SYFA_DESRM Phenylalanine--tRNA ligase alpha subunit OS=Desulfotomaculum reducens (strain MI-1) GN=pheS PE=3 SV=1 224 501 1.0E-29
sp|B7GGW8|SYFA_ANOFW Phenylalanine--tRNA ligase alpha subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pheS PE=3 SV=1 224 503 1.0E-29
sp|A9M9V4|SYFA_BRUC2 Phenylalanine--tRNA ligase alpha subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pheS PE=3 SV=1 224 502 1.0E-29
sp|Q3SWK7|SYFA_NITWN Phenylalanine--tRNA ligase alpha subunit OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pheS PE=3 SV=1 223 492 2.0E-29
sp|Q13ET5|SYFA_RHOPS Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain BisB5) GN=pheS PE=3 SV=1 224 492 2.0E-29
sp|Q92ST0|SYFA_RHIME Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium meliloti (strain 1021) GN=pheS PE=3 SV=1 224 496 2.0E-29
sp|C6DYJ1|SYFA_GEOSM Phenylalanine--tRNA ligase alpha subunit OS=Geobacter sp. (strain M21) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|Q1MRV5|SYFA_LAWIP Phenylalanine--tRNA ligase alpha subunit OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=pheS PE=3 SV=1 184 489 2.0E-29
sp|B8FFU3|SYFA_DESAA Phenylalanine--tRNA ligase alpha subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=pheS PE=3 SV=1 146 503 2.0E-29
sp|B9JYN0|SYFA_AGRVS Phenylalanine--tRNA ligase alpha subunit OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pheS PE=3 SV=1 224 496 2.0E-29
sp|A8GND9|SYFA_RICAH Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia akari (strain Hartford) GN=pheS PE=3 SV=1 224 492 2.0E-29
sp|Q49WQ5|SYFA_STAS1 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pheS PE=3 SV=1 224 507 2.0E-29
sp|Q47CM8|SYFA_DECAR Phenylalanine--tRNA ligase alpha subunit OS=Dechloromonas aromatica (strain RCB) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|Q9CC17|SYFA_MYCLE Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium leprae (strain TN) GN=pheS PE=3 SV=2 221 492 2.0E-29
sp|Q5HQ36|SYFA_STAEQ Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pheS PE=3 SV=1 224 507 2.0E-29
sp|A5V922|SYFA_SPHWW Phenylalanine--tRNA ligase alpha subunit OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=pheS PE=3 SV=1 224 489 2.0E-29
sp|B2IUA1|SYFA_NOSP7 Phenylalanine--tRNA ligase alpha subunit OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pheS PE=3 SV=1 224 503 2.0E-29
sp|B9KAE8|SYFA_THENN Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=pheS PE=3 SV=1 218 496 2.0E-29
sp|A8Z6A5|SYFA_SULMW Phenylalanine--tRNA ligase alpha subunit OS=Sulcia muelleri (strain GWSS) GN=pheS PE=3 SV=1 218 503 3.0E-29
sp|Q68WW2|SYFA_RICTY Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=pheS PE=3 SV=1 224 492 3.0E-29
sp|Q8CSY9|SYFA_STAES Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pheS PE=3 SV=1 224 507 3.0E-29
sp|B0C6I2|SYFA_ACAM1 Phenylalanine--tRNA ligase alpha subunit OS=Acaryochloris marina (strain MBIC 11017) GN=pheS PE=3 SV=1 224 503 4.0E-29
sp|Q6MT17|SYFA_MYCMS Phenylalanine--tRNA ligase alpha subunit OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=pheS PE=3 SV=1 125 496 5.0E-29
sp|A9ILQ3|SYFA_BART1 Phenylalanine--tRNA ligase alpha subunit OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pheS PE=3 SV=1 224 489 6.0E-29
sp|Q251I2|SYFA_DESHY Phenylalanine--tRNA ligase alpha subunit OS=Desulfitobacterium hafniense (strain Y51) GN=pheS PE=3 SV=1 136 503 6.0E-29
sp|Q1MMP3|SYFA_RHIL3 Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pheS PE=3 SV=1 224 496 6.0E-29
sp|Q1WTY9|SYFA_LACS1 Phenylalanine--tRNA ligase alpha subunit OS=Lactobacillus salivarius (strain UCC118) GN=pheS PE=3 SV=1 218 491 7.0E-29
sp|Q8UIN5|SYFA_AGRFC Phenylalanine--tRNA ligase alpha subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pheS PE=3 SV=1 224 496 7.0E-29
sp|Q6G5E3|SYFA_BARHE Phenylalanine--tRNA ligase alpha subunit OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pheS PE=3 SV=1 224 489 8.0E-29
sp|A6GVW9|SYFA_FLAPJ Phenylalanine--tRNA ligase alpha subunit OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pheS PE=3 SV=1 224 503 8.0E-29
sp|B8J4E0|SYFA_DESDA Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pheS PE=3 SV=1 223 496 9.0E-29
sp|B4SB89|SYFA_PELPB Phenylalanine--tRNA ligase alpha subunit OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=pheS PE=3 SV=1 223 492 1.0E-28
sp|Q9ZDB5|SYFA_RICPR Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia prowazekii (strain Madrid E) GN=pheS PE=3 SV=1 224 492 1.0E-28
sp|Q2GAI8|SYFA_NOVAD Phenylalanine--tRNA ligase alpha subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pheS PE=3 SV=1 220 489 1.0E-28
sp|A6UF74|SYFA_SINMW Phenylalanine--tRNA ligase alpha subunit OS=Sinorhizobium medicae (strain WSM419) GN=pheS PE=3 SV=1 224 496 1.0E-28
sp|B2A5N5|SYFA_NATTJ Phenylalanine--tRNA ligase alpha subunit OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pheS PE=3 SV=1 224 489 1.0E-28
sp|C5BSQ6|SYFA_TERTT Phenylalanine--tRNA ligase alpha subunit OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pheS PE=3 SV=1 218 498 1.0E-28
sp|Q65GD2|SYFA_BACLD Phenylalanine--tRNA ligase alpha subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pheS PE=3 SV=1 218 496 1.0E-28
sp|Q891T7|SYFA_CLOTE Phenylalanine--tRNA ligase alpha subunit OS=Clostridium tetani (strain Massachusetts / E88) GN=pheS PE=3 SV=1 218 503 1.0E-28
sp|A5IAL3|SYFA_LEGPC Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila (strain Corby) GN=pheS PE=3 SV=1 218 503 1.0E-28
sp|Q2RHN7|SYFA_MOOTA Phenylalanine--tRNA ligase alpha subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=pheS PE=3 SV=1 224 501 1.0E-28
sp|Q3ABT4|SYFA_CARHZ Phenylalanine--tRNA ligase alpha subunit OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pheS PE=3 SV=1 218 502 1.0E-28
sp|A6VYH7|SYFA_MARMS Phenylalanine--tRNA ligase alpha subunit OS=Marinomonas sp. (strain MWYL1) GN=pheS PE=3 SV=1 218 503 1.0E-28
sp|C4ZBJ4|SYFA_EUBR3 Phenylalanine--tRNA ligase alpha subunit OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=pheS PE=3 SV=1 224 492 1.0E-28
sp|C4L450|SYFA_EXISA Phenylalanine--tRNA ligase alpha subunit OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=pheS PE=3 SV=1 218 503 2.0E-28
sp|B9J7G4|SYFA_AGRRK Phenylalanine--tRNA ligase alpha subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pheS PE=3 SV=1 224 496 2.0E-28
sp|Q0BLJ8|SYFA_FRATO Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=pheS PE=3 SV=1 133 503 2.0E-28
sp|Q2A322|SYFA_FRATH Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. holarctica (strain LVS) GN=pheS PE=3 SV=1 133 503 2.0E-28
sp|A7NCN7|SYFA_FRATF Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=pheS PE=3 SV=1 133 503 2.0E-28
sp|Q5X1H7|SYFA_LEGPA Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila (strain Paris) GN=pheS PE=3 SV=1 218 503 2.0E-28
sp|Q2KDK0|SYFA_RHIEC Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pheS PE=3 SV=1 224 496 2.0E-28
sp|Q5ZS08|SYFA_LEGPH Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pheS PE=3 SV=1 218 503 2.0E-28
sp|B4RS43|SYFA_ALTMD Phenylalanine--tRNA ligase alpha subunit OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pheS PE=3 SV=1 218 503 2.0E-28
sp|B3PYE2|SYFA_RHIE6 Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium etli (strain CIAT 652) GN=pheS PE=3 SV=1 224 496 2.0E-28
sp|C3MCQ0|SYFA_RHISN Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium sp. (strain NGR234) GN=pheS PE=3 SV=1 224 496 2.0E-28
sp|Q3J5M4|SYFA_RHOS4 Phenylalanine--tRNA ligase alpha subunit OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pheS PE=3 SV=1 218 489 2.0E-28
sp|A3PGQ9|SYFA_RHOS1 Phenylalanine--tRNA ligase alpha subunit OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pheS PE=3 SV=1 218 489 2.0E-28
sp|Q2YX87|SYFA_STAAB Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|P68850|SYFA_STAAW Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain MW2) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|P68849|SYFA_STAAU Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|Q6GA76|SYFA_STAAS Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain MSSA476) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|Q6GHU7|SYFA_STAAR Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain MRSA252) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|P68848|SYFA_STAAN Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain N315) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|P68847|SYFA_STAAM Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|A5IS24|SYFA_STAA9 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain JH9) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|A6U0V5|SYFA_STAA2 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain JH1) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|A7X160|SYFA_STAA1 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|Q28V93|SYFA_JANSC Phenylalanine--tRNA ligase alpha subunit OS=Jannaschia sp. (strain CCS1) GN=pheS PE=3 SV=1 221 492 3.0E-28
sp|B5ZXS0|SYFA_RHILW Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pheS PE=3 SV=1 224 496 3.0E-28
sp|A8Z1R9|SYFA_STAAT Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|A6QG39|SYFA_STAAE Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain Newman) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|Q5HGU6|SYFA_STAAC Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain COL) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|Q2FZD9|SYFA_STAA8 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain NCTC 8325) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|Q2FHU3|SYFA_STAA3 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain USA300) GN=pheS PE=3 SV=1 224 507 3.0E-28
sp|A1TAB5|SYFA_MYCVP Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pheS PE=3 SV=1 221 492 3.0E-28
sp|Q1D6E0|SYFA_MYXXD Phenylalanine--tRNA ligase alpha subunit OS=Myxococcus xanthus (strain DK 1622) GN=pheS PE=3 SV=1 224 492 3.0E-28
sp|Q74D00|SYFA_GEOSL Phenylalanine--tRNA ligase alpha subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pheS PE=3 SV=1 224 496 3.0E-28
sp|A7MVJ5|SYFA_VIBCB Phenylalanine--tRNA ligase alpha subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pheS PE=3 SV=1 224 503 3.0E-28
sp|Q7MK39|SYFA_VIBVY Phenylalanine--tRNA ligase alpha subunit OS=Vibrio vulnificus (strain YJ016) GN=pheS PE=3 SV=1 224 503 3.0E-28
sp|Q8DA40|SYFA_VIBVU Phenylalanine--tRNA ligase alpha subunit OS=Vibrio vulnificus (strain CMCP6) GN=pheS PE=3 SV=1 224 503 3.0E-28
sp|Q2NJZ3|SYFA_AYWBP Phenylalanine--tRNA ligase alpha subunit OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=pheS PE=3 SV=1 187 489 3.0E-28
sp|B3QRM0|SYFA_CHLP8 Phenylalanine--tRNA ligase alpha subunit OS=Chlorobaculum parvum (strain NCIB 8327) GN=pheS PE=3 SV=1 223 498 3.0E-28
sp|A8LLH4|SYFA_DINSH Phenylalanine--tRNA ligase alpha subunit OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pheS PE=3 SV=1 218 489 4.0E-28
sp|Q2N631|SYFA_ERYLH Phenylalanine--tRNA ligase alpha subunit OS=Erythrobacter litoralis (strain HTCC2594) GN=pheS PE=3 SV=1 221 489 4.0E-28
sp|Q5WT86|SYFA_LEGPL Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila (strain Lens) GN=pheS PE=3 SV=1 218 503 4.0E-28
sp|Q7UP75|SYFA_RHOBA Phenylalanine--tRNA ligase alpha subunit OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pheS PE=3 SV=1 218 503 4.0E-28
sp|B9KLE0|SYFA_RHOSK Phenylalanine--tRNA ligase alpha subunit OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pheS PE=3 SV=1 218 489 4.0E-28
sp|A0Q6A6|SYFA_FRATN Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. novicida (strain U112) GN=pheS PE=3 SV=1 133 503 5.0E-28
sp|B9M520|SYFA_GEODF Phenylalanine--tRNA ligase alpha subunit OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pheS PE=3 SV=1 223 503 5.0E-28
sp|A4T9V2|SYFA_MYCGI Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=pheS PE=3 SV=1 221 492 5.0E-28
sp|B2SGL8|SYFA_FRATM Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=pheS PE=3 SV=1 133 503 5.0E-28
sp|B1HWA2|SYFA_LYSSC Phenylalanine--tRNA ligase alpha subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=pheS PE=3 SV=1 224 489 5.0E-28
sp|A5IIW2|SYFA_THEP1 Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pheS PE=3 SV=1 218 496 6.0E-28
sp|B1YJZ8|SYFA_EXIS2 Phenylalanine--tRNA ligase alpha subunit OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=pheS PE=3 SV=1 218 496 6.0E-28
sp|B1LCK9|SYFA_THESQ Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga sp. (strain RQ2) GN=pheS PE=3 SV=1 218 496 7.0E-28
sp|Q9WZS8|SYFA_THEMA Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pheS PE=3 SV=1 218 496 7.0E-28
sp|Q1GDM3|SYFA_RUEST Phenylalanine--tRNA ligase alpha subunit OS=Ruegeria sp. (strain TM1040) GN=pheS PE=3 SV=1 224 489 7.0E-28
sp|A5G4T3|SYFA_GEOUR Phenylalanine--tRNA ligase alpha subunit OS=Geobacter uraniireducens (strain Rf4) GN=pheS PE=3 SV=1 218 503 7.0E-28
sp|Q39VS5|SYFA_GEOMG Phenylalanine--tRNA ligase alpha subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pheS PE=3 SV=1 224 496 8.0E-28
sp|B2IGL6|SYFA_BEII9 Phenylalanine--tRNA ligase alpha subunit OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=pheS PE=3 SV=1 182 489 9.0E-28
sp|A4IXV3|SYFA_FRATW Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=pheS PE=3 SV=1 133 503 9.0E-28
sp|Q5NG53|SYFA_FRATT Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pheS PE=3 SV=1 133 503 9.0E-28
sp|Q14HK5|SYFA_FRAT1 Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=pheS PE=3 SV=1 133 503 9.0E-28
sp|Q9K895|SYFA_BACHD Phenylalanine--tRNA ligase alpha subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pheS PE=3 SV=1 224 491 1.0E-27
sp|Q3MB99|SYFA_ANAVT Phenylalanine--tRNA ligase alpha subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pheS PE=3 SV=1 224 503 1.0E-27
sp|A0PZN8|SYFA_CLONN Phenylalanine--tRNA ligase alpha subunit OS=Clostridium novyi (strain NT) GN=pheS PE=3 SV=1 218 503 1.0E-27
sp|A0KKP5|SYFA_AERHH Phenylalanine--tRNA ligase alpha subunit OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pheS PE=3 SV=1 224 503 1.0E-27
sp|Q8YMT4|SYFA_NOSS1 Phenylalanine--tRNA ligase alpha subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pheS PE=3 SV=1 224 503 1.0E-27
sp|A4XTS5|SYFA_PSEMY Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas mendocina (strain ymp) GN=pheS PE=3 SV=1 90 501 1.0E-27
sp|Q9A9E4|SYFA_CAUCR Phenylalanine--tRNA ligase alpha subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pheS PE=3 SV=1 224 506 1.0E-27
sp|B8H307|SYFA_CAUCN Phenylalanine--tRNA ligase alpha subunit OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pheS PE=3 SV=1 224 506 1.0E-27
sp|Q6AGD7|SYFA_LEIXX Phenylalanine--tRNA ligase alpha subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pheS PE=3 SV=1 213 491 1.0E-27
sp|A4SMA8|SYFA_AERS4 Phenylalanine--tRNA ligase alpha subunit OS=Aeromonas salmonicida (strain A449) GN=pheS PE=3 SV=1 224 503 1.0E-27
sp|B0SJ52|SYFA_LEPBP Phenylalanine--tRNA ligase alpha subunit OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pheS PE=3 SV=1 224 489 1.0E-27
sp|B0SBK8|SYFA_LEPBA Phenylalanine--tRNA ligase alpha subunit OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=pheS PE=3 SV=1 224 489 1.0E-27
sp|Q5QXL7|SYFA_IDILO Phenylalanine--tRNA ligase alpha subunit OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pheS PE=3 SV=1 218 503 1.0E-27
sp|Q6G0Y4|SYFA_BARQU Phenylalanine--tRNA ligase alpha subunit OS=Bartonella quintana (strain Toulouse) GN=pheS PE=3 SV=1 224 489 1.0E-27
sp|Q3APW3|SYFA_CHLCH Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium chlorochromatii (strain CaD3) GN=pheS PE=3 SV=1 223 498 1.0E-27
sp|Q6YPX9|SYFA_ONYPE Phenylalanine--tRNA ligase alpha subunit OS=Onion yellows phytoplasma (strain OY-M) GN=pheS PE=3 SV=1 224 489 2.0E-27
sp|Q6LQ72|SYFA_PHOPR Phenylalanine--tRNA ligase alpha subunit OS=Photobacterium profundum GN=pheS PE=3 SV=2 224 503 2.0E-27
sp|Q60AZ0|SYFA_METCA Phenylalanine--tRNA ligase alpha subunit OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pheS PE=3 SV=1 218 501 2.0E-27
sp|A5FLW1|SYFA_FLAJ1 Phenylalanine--tRNA ligase alpha subunit OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|A0M6W9|SYFA_GRAFK Phenylalanine--tRNA ligase alpha subunit OS=Gramella forsetii (strain KT0803) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|Q7NGP0|SYFA_GLOVI Phenylalanine--tRNA ligase alpha subunit OS=Gloeobacter violaceus (strain PCC 7421) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|Q3Z9I8|SYFA_DEHM1 Phenylalanine--tRNA ligase alpha subunit OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pheS PE=3 SV=1 224 489 2.0E-27
sp|C0QT55|SYFA_PERMH Phenylalanine--tRNA ligase alpha subunit OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=pheS PE=3 SV=1 223 492 2.0E-27
sp|Q87Q60|SYFA_VIBPA Phenylalanine--tRNA ligase alpha subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|B5FDX4|SYFA_VIBFM Phenylalanine--tRNA ligase alpha subunit OS=Vibrio fischeri (strain MJ11) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|Q5E5G6|SYFA_VIBF1 Phenylalanine--tRNA ligase alpha subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|C3LLR5|SYFA_VIBCM Phenylalanine--tRNA ligase alpha subunit OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|Q9KSN7|SYFA_VIBCH Phenylalanine--tRNA ligase alpha subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|A5F1W4|SYFA_VIBC3 Phenylalanine--tRNA ligase alpha subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|Q30Y15|SYFA_DESAG Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio alaskensis (strain G20) GN=pheS PE=3 SV=1 223 496 2.0E-27
sp|B0U0C4|SYFA_FRAP2 Phenylalanine--tRNA ligase alpha subunit OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pheS PE=3 SV=1 218 503 2.0E-27
sp|B7VPK0|SYFA_VIBTL Phenylalanine--tRNA ligase alpha subunit OS=Vibrio tasmaniensis (strain LGP32) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|A9KHY1|SYFA_CLOPH Phenylalanine--tRNA ligase alpha subunit OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|A5D0U1|SYFA_PELTS Phenylalanine--tRNA ligase alpha subunit OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pheS PE=3 SV=1 223 503 2.0E-27
sp|B1VA93|SYFA_PHYAS Phenylalanine--tRNA ligase alpha subunit OS=Phytoplasma australiense GN=pheS PE=3 SV=1 156 503 3.0E-27
sp|A1B4B8|SYFA_PARDP Phenylalanine--tRNA ligase alpha subunit OS=Paracoccus denitrificans (strain Pd 1222) GN=pheS PE=3 SV=1 218 489 3.0E-27
sp|Q5LMG9|SYFA_RUEPO Phenylalanine--tRNA ligase alpha subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pheS PE=3 SV=1 220 489 3.0E-27
sp|B4R9C6|SYFA_PHEZH Phenylalanine--tRNA ligase alpha subunit OS=Phenylobacterium zucineum (strain HLK1) GN=pheS PE=3 SV=1 224 496 3.0E-27
sp|A4SCK0|SYFA_CHLPM Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=pheS PE=3 SV=1 223 496 3.0E-27
sp|Q82VV5|SYFA_NITEU Phenylalanine--tRNA ligase alpha subunit OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=pheS PE=3 SV=1 128 503 3.0E-27
sp|A1ARE1|SYFA_PELPD Phenylalanine--tRNA ligase alpha subunit OS=Pelobacter propionicus (strain DSM 2379) GN=pheS PE=3 SV=1 218 496 4.0E-27
sp|B3EEB7|SYFA_CHLL2 Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pheS PE=3 SV=1 218 506 4.0E-27
sp|Q8KAM6|SYFA_CHLTE Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pheS PE=3 SV=1 224 498 4.0E-27
sp|Q5GTJ5|SYFA_WOLTR Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pheS PE=3 SV=1 130 496 4.0E-27
sp|Q8XZ25|SYFA_RALSO Phenylalanine--tRNA ligase alpha subunit OS=Ralstonia solanacearum (strain GMI1000) GN=pheS PE=3 SV=1 218 489 4.0E-27
sp|B2UGJ4|SYFA_RALPJ Phenylalanine--tRNA ligase alpha subunit OS=Ralstonia pickettii (strain 12J) GN=pheS PE=3 SV=1 218 489 4.0E-27
sp|A0AHW2|SYFA_LISW6 Phenylalanine--tRNA ligase alpha subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pheS PE=3 SV=1 134 503 4.0E-27
sp|Q2RNH8|SYFA_RHORT Phenylalanine--tRNA ligase alpha subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pheS PE=3 SV=1 219 489 4.0E-27
sp|B6EN08|SYFA_ALISL Phenylalanine--tRNA ligase alpha subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=pheS PE=3 SV=1 224 503 4.0E-27
sp|C4LFG9|SYFA_TOLAT Phenylalanine--tRNA ligase alpha subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pheS PE=3 SV=1 224 503 5.0E-27
sp|A1BJB6|SYFA_CHLPD Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium phaeobacteroides (strain DSM 266) GN=pheS PE=3 SV=1 224 498 7.0E-27
sp|A0QHB6|SYFA_MYCA1 Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium avium (strain 104) GN=pheS PE=3 SV=1 221 492 7.0E-27
sp|Q7N3Q0|SYFA_PHOLL Phenylalanine--tRNA ligase alpha subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pheS PE=3 SV=1 131 503 7.0E-27
sp|A1U2B9|SYFA_MARHV Phenylalanine--tRNA ligase alpha subunit OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pheS PE=3 SV=1 218 501 7.0E-27
sp|B8IP76|SYFA_METNO Phenylalanine--tRNA ligase alpha subunit OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=pheS PE=3 SV=1 221 489 8.0E-27
sp|Q3ZZD3|SYFA_DEHMC Phenylalanine--tRNA ligase alpha subunit OS=Dehalococcoides mccartyi (strain CBDB1) GN=pheS PE=3 SV=1 224 489 8.0E-27
sp|A5FS95|SYFA_DEHMB Phenylalanine--tRNA ligase alpha subunit OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pheS PE=3 SV=1 224 489 8.0E-27
sp|Q740J1|SYFA_MYCPA Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pheS PE=3 SV=1 221 492 8.0E-27
sp|B2TS55|SYFA_CLOBB Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pheS PE=3 SV=1 218 503 8.0E-27
sp|B2V594|SYFA_CLOBA Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pheS PE=3 SV=1 218 503 8.0E-27
sp|B3PL12|SYFA_CELJU Phenylalanine--tRNA ligase alpha subunit OS=Cellvibrio japonicus (strain Ueda107) GN=pheS PE=3 SV=1 218 503 9.0E-27
sp|A6L2I3|SYFA_BACV8 Phenylalanine--tRNA ligase alpha subunit OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=pheS PE=3 SV=1 224 489 9.0E-27
sp|C3KTJ3|SYFA_CLOB6 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain 657 / Type Ba4) GN=pheS PE=3 SV=1 218 503 9.0E-27
sp|Q47ZS4|SYFA_COLP3 Phenylalanine--tRNA ligase alpha subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pheS PE=3 SV=1 218 503 9.0E-27
sp|A7GHZ8|SYFA_CLOBL Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pheS PE=3 SV=1 218 503 9.0E-27
sp|Q3A4N9|SYFA_PELCD Phenylalanine--tRNA ligase alpha subunit OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pheS PE=3 SV=1 218 496 1.0E-26
sp|Q0KBY9|SYFA_CUPNH Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pheS PE=3 SV=1 224 489 1.0E-26
sp|Q15SX7|SYFA_PSEA6 Phenylalanine--tRNA ligase alpha subunit OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|B1IML3|SYFA_CLOBK Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Okra / Type B1) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|C1FKM3|SYFA_CLOBJ Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|A5I6L1|SYFA_CLOBH Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|A7FY80|SYFA_CLOB1 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|B3R4J5|SYFA_CUPTR Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pheS PE=3 SV=1 224 489 1.0E-26
sp|Q472N4|SYFA_CUPPJ Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pheS PE=3 SV=1 224 489 1.0E-26
sp|C1DDA2|SYFA_LARHH Phenylalanine--tRNA ligase alpha subunit OS=Laribacter hongkongensis (strain HLHK9) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|C1ANS2|SYFA_MYCBT Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pheS PE=3 SV=1 223 492 1.0E-26
sp|A1KJ66|SYFA_MYCBP Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pheS PE=3 SV=1 223 492 1.0E-26
sp|Q7VEV4|SYFA_MYCBO Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pheS PE=3 SV=1 223 492 1.0E-26
sp|Q98CP9|SYFA_RHILO Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium loti (strain MAFF303099) GN=pheS PE=3 SV=1 224 496 1.0E-26
sp|P9WFU3|SYFA_MYCTU Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pheS PE=1 SV=1 223 492 1.0E-26
sp|P9WFU2|SYFA_MYCTO Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pheS PE=3 SV=1 223 492 1.0E-26
sp|A5U306|SYFA_MYCTA Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pheS PE=3 SV=1 223 492 1.0E-26
sp|Q6MDC0|SYFA_PARUW Phenylalanine--tRNA ligase alpha subunit OS=Protochlamydia amoebophila (strain UWE25) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|Q5HC40|SYFA_EHRRW Phenylalanine--tRNA ligase alpha subunit OS=Ehrlichia ruminantium (strain Welgevonden) GN=pheS PE=3 SV=1 221 491 1.0E-26
sp|Q5FH45|SYFA_EHRRG Phenylalanine--tRNA ligase alpha subunit OS=Ehrlichia ruminantium (strain Gardel) GN=pheS PE=3 SV=1 221 491 1.0E-26
sp|B1L0T0|SYFA_CLOBM Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|Q4FQ65|SYFA_PSYA2 Phenylalanine--tRNA ligase alpha subunit OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pheS PE=3 SV=1 224 496 2.0E-26
sp|A9B8B9|SYFA_HERA2 Phenylalanine--tRNA ligase alpha subunit OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pheS PE=3 SV=1 187 489 2.0E-26
sp|A1S702|SYFA_SHEAM Phenylalanine--tRNA ligase alpha subunit OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pheS PE=3 SV=1 154 503 2.0E-26
sp|B0SXZ7|SYFA_CAUSK Phenylalanine--tRNA ligase alpha subunit OS=Caulobacter sp. (strain K31) GN=pheS PE=3 SV=1 224 491 2.0E-26
sp|Q9JR76|SYFA_NEIMA Phenylalanine--tRNA ligase alpha subunit OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|A4G615|SYFA_HERAR Phenylalanine--tRNA ligase alpha subunit OS=Herminiimonas arsenicoxydans GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|Q92CI7|SYFA_LISIN Phenylalanine--tRNA ligase alpha subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pheS PE=3 SV=1 134 503 2.0E-26
sp|B2V6V0|SYFA_SULSY Phenylalanine--tRNA ligase alpha subunit OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=pheS PE=3 SV=1 225 500 2.0E-26
sp|A6LTR7|SYFA_CLOB8 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|Q4ZUG3|SYFA_PSEU2 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pheS PE=3 SV=1 218 501 3.0E-26
sp|Q48JR9|SYFA_PSE14 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pheS PE=3 SV=1 218 501 3.0E-26
sp|Q883H8|SYFA_PSESM Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pheS PE=3 SV=1 218 501 3.0E-26
sp|Q8Y7Q2|SYFA_LISMO Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|Q8DL09|SYFA_THEEB Phenylalanine--tRNA ligase alpha subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|B8E7F5|SYFA_SHEB2 Phenylalanine--tRNA ligase alpha subunit OS=Shewanella baltica (strain OS223) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|Q9K092|SYFA_NEIMB Phenylalanine--tRNA ligase alpha subunit OS=Neisseria meningitidis serogroup B (strain MC58) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|B0UPJ5|SYFA_METS4 Phenylalanine--tRNA ligase alpha subunit OS=Methylobacterium sp. (strain 4-46) GN=pheS PE=3 SV=1 221 489 3.0E-26
sp|Q5F9U0|SYFA_NEIG1 Phenylalanine--tRNA ligase alpha subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pheS PE=3 SV=2 218 503 3.0E-26
sp|B8DI11|SYFA_LISMH Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pheS PE=3 SV=1 218 503 4.0E-26
sp|Q720K8|SYFA_LISMF Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pheS PE=3 SV=1 218 503 4.0E-26
sp|B8GRI4|SYFA_THISH Phenylalanine--tRNA ligase alpha subunit OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=pheS PE=3 SV=1 218 489 4.0E-26
sp|A6WMK4|SYFA_SHEB8 Phenylalanine--tRNA ligase alpha subunit OS=Shewanella baltica (strain OS185) GN=pheS PE=3 SV=1 218 503 4.0E-26
sp|A1VBB8|SYFA_DESVV Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=pheS PE=3 SV=1 224 496 5.0E-26
sp|Q728R9|SYFA_DESVH Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pheS PE=3 SV=1 224 496 5.0E-26
sp|Q2GHR3|SYFA_EHRCR Phenylalanine--tRNA ligase alpha subunit OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=pheS PE=3 SV=1 226 496 5.0E-26
sp|A1RK14|SYFA_SHESW Phenylalanine--tRNA ligase alpha subunit OS=Shewanella sp. (strain W3-18-1) GN=pheS PE=3 SV=1 218 503 5.0E-26
sp|A4Y6G8|SYFA_SHEPC Phenylalanine--tRNA ligase alpha subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pheS PE=3 SV=1 218 503 5.0E-26
sp|Q5PBV2|SYFA_ANAMM Phenylalanine--tRNA ligase alpha subunit OS=Anaplasma marginale (strain St. Maries) GN=pheS PE=3 SV=1 221 497 5.0E-26
sp|Q3KEX8|SYFA_PSEPF Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas fluorescens (strain Pf0-1) GN=pheS PE=3 SV=1 218 501 6.0E-26
sp|Q828C7|SYFA_STRAW Phenylalanine--tRNA ligase alpha subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pheS PE=3 SV=1 223 492 6.0E-26
sp|Q47N75|SYFA_THEFY Phenylalanine--tRNA ligase alpha subunit OS=Thermobifida fusca (strain YX) GN=pheS PE=3 SV=1 224 492 6.0E-26
sp|A6SY34|SYFA_JANMA Phenylalanine--tRNA ligase alpha subunit OS=Janthinobacterium sp. (strain Marseille) GN=pheS PE=3 SV=1 218 503 6.0E-26
sp|A2SH03|SYFA_METPP Phenylalanine--tRNA ligase alpha subunit OS=Methylibium petroleiphilum (strain PM1) GN=pheS PE=3 SV=1 218 489 6.0E-26
sp|Q88WR3|SYFA_LACPL Phenylalanine--tRNA ligase alpha subunit OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pheS PE=3 SV=1 224 489 7.0E-26
sp|Q0AY00|SYFA_SYNWW Phenylalanine--tRNA ligase alpha subunit OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=pheS PE=3 SV=1 218 489 7.0E-26
sp|Q8EYR3|SYFA_LEPIN Phenylalanine--tRNA ligase alpha subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pheS PE=3 SV=1 224 489 7.0E-26
sp|Q72M80|SYFA_LEPIC Phenylalanine--tRNA ligase alpha subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pheS PE=3 SV=1 224 489 7.0E-26
sp|Q5WEJ5|SYFA_BACSK Phenylalanine--tRNA ligase alpha subunit OS=Bacillus clausii (strain KSM-K16) GN=pheS PE=3 SV=1 224 501 7.0E-26
sp|Q1LP76|SYFA_CUPMC Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pheS PE=3 SV=1 224 489 8.0E-26
sp|B1XYZ7|SYFA_LEPCP Phenylalanine--tRNA ligase alpha subunit OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pheS PE=3 SV=1 218 501 8.0E-26
sp|C3JZN3|SYFA_PSEFS Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas fluorescens (strain SBW25) GN=pheS PE=3 SV=1 88 501 9.0E-26
sp|B3QUV1|SYFA_CHLT3 Phenylalanine--tRNA ligase alpha subunit OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=pheS PE=3 SV=1 95 489 1.0E-25
sp|B4ETL0|SYFA_PROMH Phenylalanine--tRNA ligase alpha subunit OS=Proteus mirabilis (strain HI4320) GN=pheS PE=3 SV=1 224 503 1.0E-25
sp|Q1IC11|SYFA_PSEE4 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas entomophila (strain L48) GN=pheS PE=3 SV=1 88 501 1.0E-25
sp|Q056G0|SYFA_LEPBL Phenylalanine--tRNA ligase alpha subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pheS PE=3 SV=1 224 489 1.0E-25
sp|Q04P74|SYFA_LEPBJ Phenylalanine--tRNA ligase alpha subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pheS PE=3 SV=1 224 489 1.0E-25
sp|Q8P7Z5|SYFA_XANCP Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pheS PE=3 SV=1 224 496 1.0E-25
sp|B0RRH3|SYFA_XANCB Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas campestris pv. campestris (strain B100) GN=pheS PE=3 SV=1 224 496 1.0E-25
sp|Q4UW53|SYFA_XANC8 Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pheS PE=3 SV=1 224 496 1.0E-25
sp|Q16BG6|SYFA_ROSDO Phenylalanine--tRNA ligase alpha subunit OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pheS PE=3 SV=1 224 489 1.0E-25
sp|Q4KEW0|SYFA_PSEF5 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pheS PE=3 SV=1 218 501 1.0E-25
sp|Q7NYC2|SYFA_CHRVO Phenylalanine--tRNA ligase alpha subunit OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pheS PE=3 SV=1 223 503 1.0E-25
sp|Q0HUP8|SYFA_SHESR Phenylalanine--tRNA ligase alpha subunit OS=Shewanella sp. (strain MR-7) GN=pheS PE=3 SV=1 218 503 2.0E-25
sp|A1A1X6|SYFA_BIFAA Phenylalanine--tRNA ligase alpha subunit OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pheS PE=3 SV=1 211 492 2.0E-25
sp|Q2SDJ6|SYFA_HAHCH Phenylalanine--tRNA ligase alpha subunit OS=Hahella chejuensis (strain KCTC 2396) GN=pheS PE=3 SV=1 218 503 2.0E-25
sp|C1DF46|SYFA_AZOVD Phenylalanine--tRNA ligase alpha subunit OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pheS PE=3 SV=1 218 489 2.0E-25
sp|Q6F872|SYFA_ACIAD Phenylalanine--tRNA ligase alpha subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pheS PE=3 SV=1 218 489 2.0E-25
sp|B0V5Q6|SYFA_ACIBY Phenylalanine--tRNA ligase alpha subunit OS=Acinetobacter baumannii (strain AYE) GN=pheS PE=3 SV=1 218 489 2.0E-25
sp|B0VV85|SYFA_ACIBS Phenylalanine--tRNA ligase alpha subunit OS=Acinetobacter baumannii (strain SDF) GN=pheS PE=3 SV=1 218 489 2.0E-25
sp|Q7VVR4|SYFA_BORPE Phenylalanine--tRNA ligase alpha subunit OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pheS PE=3 SV=1 218 501 2.0E-25
sp|Q7WKR5|SYFA_BORBR Phenylalanine--tRNA ligase alpha subunit OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pheS PE=3 SV=1 218 501 2.0E-25
sp|Q8A756|SYFA_BACTN Phenylalanine--tRNA ligase alpha subunit OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pheS PE=3 SV=1 224 489 3.0E-25
sp|Q6D4H2|SYFA_PECAS Phenylalanine--tRNA ligase alpha subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pheS PE=3 SV=1 224 503 3.0E-25
sp|Q3Z262|SYFA_SHISS Phenylalanine--tRNA ligase alpha subunit OS=Shigella sonnei (strain Ss046) GN=pheS PE=3 SV=1 217 503 3.0E-25
sp|C5B850|SYFA_EDWI9 Phenylalanine--tRNA ligase alpha subunit OS=Edwardsiella ictaluri (strain 93-146) GN=pheS PE=3 SV=1 224 503 3.0E-25
sp|Q8NQN7|SYFA_CORGL Phenylalanine--tRNA ligase alpha subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pheS PE=3 SV=1 221 492 4.0E-25
sp|Q11KJ9|SYFA_CHESB Phenylalanine--tRNA ligase alpha subunit OS=Chelativorans sp. (strain BNC1) GN=pheS PE=3 SV=1 224 496 4.0E-25
sp|B5XQD0|SYFA_KLEP3 Phenylalanine--tRNA ligase alpha subunit OS=Klebsiella pneumoniae (strain 342) GN=pheS PE=3 SV=1 224 503 4.0E-25
sp|Q97GK9|SYFA_CLOAB Phenylalanine--tRNA ligase alpha subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pheS PE=3 SV=1 218 503 4.0E-25
sp|Q8EFA0|SYFA_SHEON Phenylalanine--tRNA ligase alpha subunit OS=Shewanella oneidensis (strain MR-1) GN=pheS PE=3 SV=1 224 503 4.0E-25
sp|B1MXE0|SYFA_LEUCK Phenylalanine--tRNA ligase alpha subunit OS=Leuconostoc citreum (strain KM20) GN=pheS PE=3 SV=1 218 491 4.0E-25
sp|A6TAI3|SYFA_KLEP7 Phenylalanine--tRNA ligase alpha subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pheS PE=3 SV=1 224 503 4.0E-25
sp|B6IPK0|SYFA_RHOCS Phenylalanine--tRNA ligase alpha subunit OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pheS PE=3 SV=1 224 489 5.0E-25
sp|Q321K6|SYFA_SHIBS Phenylalanine--tRNA ligase alpha subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|P08312|SYFA_ECOLI Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12) GN=pheS PE=1 SV=2 224 503 6.0E-25
sp|B1IPL3|SYFA_ECOLC Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|A8A0Q6|SYFA_ECOHS Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O9:H4 (strain HS) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|B1XG21|SYFA_ECODH Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12 / DH10B) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|C4ZYH6|SYFA_ECOBW Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|B7M1C3|SYFA_ECO8A Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O8 (strain IAI1) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|A7ZMI2|SYFA_ECO24 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|C1L2C6|SYFA_LISMC Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pheS PE=3 SV=1 218 503 6.0E-25
sp|Q8RHB4|SYFA_FUSNN Phenylalanine--tRNA ligase alpha subunit OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pheS PE=3 SV=1 218 489 6.0E-25
sp|B1M6P5|SYFA_METRJ Phenylalanine--tRNA ligase alpha subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=pheS PE=3 SV=1 224 489 6.0E-25
sp|A4W9M7|SYFA_ENT38 Phenylalanine--tRNA ligase alpha subunit OS=Enterobacter sp. (strain 638) GN=pheS PE=3 SV=1 224 503 6.0E-25
sp|Q64R71|SYFA_BACFR Phenylalanine--tRNA ligase alpha subunit OS=Bacteroides fragilis (strain YCH46) GN=pheS PE=3 SV=1 224 489 7.0E-25
sp|Q5LAS4|SYFA_BACFN Phenylalanine--tRNA ligase alpha subunit OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pheS PE=3 SV=1 224 489 7.0E-25
sp|Q31F18|SYFA_THICR Phenylalanine--tRNA ligase alpha subunit OS=Thiomicrospira crunogena (strain XCL-2) GN=pheS PE=3 SV=1 218 503 7.0E-25
sp|Q0T4S4|SYFA_SHIF8 Phenylalanine--tRNA ligase alpha subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B7LQ75|SYFA_ESCF3 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B1LE16|SYFA_ECOSM Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B6I8Q7|SYFA_ECOSE Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain SE11) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B7N552|SYFA_ECOLU Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|P67036|SYFA_ECOL6 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|Q0THB4|SYFA_ECOL5 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B7MVJ3|SYFA_ECO81 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O81 (strain ED1a) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B7NT62|SYFA_ECO7I Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B5YQ02|SYFA_ECO5E Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|P67037|SYFA_ECO57 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O157:H7 GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B7L6I7|SYFA_ECO55 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain 55989 / EAEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B7MAS5|SYFA_ECO45 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B7US97|SYFA_ECO27 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|A1WMG9|SYFA_VEREI Phenylalanine--tRNA ligase alpha subunit OS=Verminephrobacter eiseniae (strain EF01-2) GN=pheS PE=3 SV=1 218 489 8.0E-25
sp|Q32FI5|SYFA_SHIDS Phenylalanine--tRNA ligase alpha subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|B3E1T9|SYFA_GEOLS Phenylalanine--tRNA ligase alpha subunit OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pheS PE=3 SV=1 218 496 8.0E-25
sp|B3WF19|SYFA_LACCB Phenylalanine--tRNA ligase alpha subunit OS=Lactobacillus casei (strain BL23) GN=pheS PE=3 SV=1 223 512 8.0E-25
sp|Q2NT28|SYFA_SODGM Phenylalanine--tRNA ligase alpha subunit OS=Sodalis glossinidius (strain morsitans) GN=pheS PE=3 SV=1 224 503 9.0E-25
sp|B8DU51|SYFA_BIFA0 Phenylalanine--tRNA ligase alpha subunit OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=pheS PE=3 SV=1 224 492 1.0E-24
sp|B2U392|SYFA_SHIB3 Phenylalanine--tRNA ligase alpha subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|C6DFZ0|SYFA_PECCP Phenylalanine--tRNA ligase alpha subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|Q2YBS2|SYFA_NITMU Phenylalanine--tRNA ligase alpha subunit OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pheS PE=3 SV=1 218 503 1.0E-24
sp|A6V489|SYFA_PSEA7 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas aeruginosa (strain PA7) GN=pheS PE=3 SV=1 218 501 1.0E-24
sp|Q3BRU1|SYFA_XANC5 Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pheS PE=3 SV=1 218 496 1.0E-24
sp|Q8PJE4|SYFA_XANAC Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pheS PE=3 SV=1 218 496 1.0E-24
sp|B8DPM8|SYFA_DESVM Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=pheS PE=3 SV=1 224 496 1.0E-24
sp|A7MNY9|SYFA_CROS8 Phenylalanine--tRNA ligase alpha subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|Q038C7|SYFA_LACC3 Phenylalanine--tRNA ligase alpha subunit OS=Lactobacillus casei (strain ATCC 334) GN=pheS PE=3 SV=1 223 512 2.0E-24
sp|Q4FNH5|SYFA_PELUB Phenylalanine--tRNA ligase alpha subunit OS=Pelagibacter ubique (strain HTCC1062) GN=pheS PE=3 SV=1 224 489 2.0E-24
sp|Q6NHH2|SYFA_CORDI Phenylalanine--tRNA ligase alpha subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pheS PE=3 SV=1 221 492 2.0E-24
sp|Q02NN7|SYFA_PSEAB Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pheS PE=3 SV=1 218 501 2.0E-24
sp|A6VP83|SYFA_ACTSZ Phenylalanine--tRNA ligase alpha subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pheS PE=3 SV=1 218 503 2.0E-24
sp|P67038|SYFA_SALTY Phenylalanine--tRNA ligase alpha subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pheS PE=3 SV=1 224 503 2.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0043039 tRNA aminoacylation Yes
GO:0005524 ATP binding Yes
GO:0000049 tRNA binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:0003723 RNA binding No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0003676 nucleic acid binding No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0036094 small molecule binding No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4931
MTTSSPAPAGDLATRVLQALSTQSPIQSADAFPSIPFQEVKGALDRLASRSMVTYETIEREEALLEPEAETIAAH
GSHEARVFEALKQAMDGLTVQELEQVIGDKNVTKLGQGKAFREKWISKSKDGKLVATAESIQDVTRAQLQQVKES
RTGDVKVLNDLKKRKLIRMQKIITFKIAKGPKFALEMQKEETDLTADMLTSGSWKTATFKPYNFKALGADQNAGA
LHPLNKVRHEFRQIFFEMGFQEMPTNKFVETGFWNFDALYVPQQHPARDMQDTFYISDPKAGEKPRAQVPGQDAE
AYWNNVKQVHQDGKYGSIGYRYPWSAEESLKLVLRTHTTSVSAALLHKLAATKGEDGRPKPARYFSIDRVYRNET
VDATHLAEFHQIEGVIADYGLSLGGLMEFMEIFFAKMGITDLKFKPAYNPYTEPSMEIFSFHKGLNKLVEIGNSG
MFRPEMLEAMGLPSDMRIFGWGLSLERPTMIKYKISNIRELLGHKVDLGFIERNPAVRFEQE*
Coding >OphauB2|4931
ATGACGACCTCTAGCCCTGCTCCCGCAGGTGATCTTGCCACCCGCGTGCTGCAGGCTCTGTCGACACAGAGCCCC
ATTCAATCTGCCGATGCCTTTCCCAGCATTCCGTTTCAGGAGGTCAAAGGCGCTCTCGACCGGCTGGCATCACGG
TCCATGGTTACATACGAGACGATTGAGCGCGAGGAAGCACTCCTAGAACCCGAGGCAGAAACTATTGCCGCCCAT
GGAAGTCATGAGGCGCGAGTGTTTGAGGCCTTGAAGCAGGCCATGGACGGCCTGACTGTTCAGGAGCTGGAACAA
GTCATTGGAGACAAGAATGTTACCAAGCTTGGCCAAGGCAAGGCCTTTCGCGAGAAGTGGATATCCAAGAGCAAG
GATGGCAAACTTGTTGCTACTGCTGAATCGATACAAGACGTCACCCGCGCCCAGTTACAACAAGTTAAAGAGTCG
CGAACCGGCGATGTCAAGGTTCTCAACGATCTCAAAAAGCGCAAGCTTATTCGCATGCAAAAGATTATTACTTTT
AAAATCGCAAAGGGTCCCAAATTTGCCCTTGAAATGCAAAAGGAAGAGACGGACCTCACGGCTGACATGCTCACG
TCGGGATCATGGAAAACGGCCACCTTTAAACCCTACAACTTCAAGGCTCTAGGAGCAGACCAGAACGCCGGTGCC
TTGCATCCCCTGAACAAGGTGCGGCACGAGTTCCGCCAAATTTTCTTTGAAATGGGCTTTCAGGAAATGCCGACA
AACAAGTTTGTCGAGACGGGCTTCTGGAACTTTGACGCCCTCTATGTACCGCAGCAACATCCTGCACGCGATATG
CAAGATACCTTTTACATTTCAGATCCCAAGGCTGGCGAGAAGCCGCGCGCGCAAGTGCCCGGACAGGACGCAGAA
GCGTATTGGAACAATGTCAAACAAGTACACCAGGATGGCAAGTACGGCTCGATTGGATATCGGTATCCGTGGTCG
GCCGAGGAGTCGCTGAAGCTGGTGTTGCGTACTCACACCACCTCCGTCTCGGCGGCGTTGCTGCATAAACTCGCG
GCGACCAAAGGCGAGGATGGACGACCCAAACCAGCACGGTACTTTTCTATTGATCGCGTCTACCGTAACGAAACG
GTGGATGCGACGCACTTGGCCGAATTTCATCAAATCGAGGGTGTTATTGCCGATTATGGGCTGTCCCTTGGCGGC
CTGATGGAGTTTATGGAGATTTTCTTTGCCAAGATGGGTATCACAGACCTCAAGTTTAAGCCAGCTTATAACCCC
TATACGGAACCCAGTATGGAGATTTTTAGCTTCCACAAGGGTCTCAACAAGCTGGTCGAGATTGGCAACAGCGGC
ATGTTTCGGCCAGAGATGCTCGAGGCCATGGGGCTACCCAGCGACATGCGTATCTTTGGGTGGGGTCTGAGTCTG
GAACGGCCGACGATGATCAAGTACAAGATTTCCAACATTCGCGAGCTGCTTGGACACAAGGTCGACCTGGGCTTT
ATTGAGCGGAATCCTGCAGTAAGGTTTGAGCAGGAATAG
Transcript >OphauB2|4931
ATGACGACCTCTAGCCCTGCTCCCGCAGGTGATCTTGCCACCCGCGTGCTGCAGGCTCTGTCGACACAGAGCCCC
ATTCAATCTGCCGATGCCTTTCCCAGCATTCCGTTTCAGGAGGTCAAAGGCGCTCTCGACCGGCTGGCATCACGG
TCCATGGTTACATACGAGACGATTGAGCGCGAGGAAGCACTCCTAGAACCCGAGGCAGAAACTATTGCCGCCCAT
GGAAGTCATGAGGCGCGAGTGTTTGAGGCCTTGAAGCAGGCCATGGACGGCCTGACTGTTCAGGAGCTGGAACAA
GTCATTGGAGACAAGAATGTTACCAAGCTTGGCCAAGGCAAGGCCTTTCGCGAGAAGTGGATATCCAAGAGCAAG
GATGGCAAACTTGTTGCTACTGCTGAATCGATACAAGACGTCACCCGCGCCCAGTTACAACAAGTTAAAGAGTCG
CGAACCGGCGATGTCAAGGTTCTCAACGATCTCAAAAAGCGCAAGCTTATTCGCATGCAAAAGATTATTACTTTT
AAAATCGCAAAGGGTCCCAAATTTGCCCTTGAAATGCAAAAGGAAGAGACGGACCTCACGGCTGACATGCTCACG
TCGGGATCATGGAAAACGGCCACCTTTAAACCCTACAACTTCAAGGCTCTAGGAGCAGACCAGAACGCCGGTGCC
TTGCATCCCCTGAACAAGGTGCGGCACGAGTTCCGCCAAATTTTCTTTGAAATGGGCTTTCAGGAAATGCCGACA
AACAAGTTTGTCGAGACGGGCTTCTGGAACTTTGACGCCCTCTATGTACCGCAGCAACATCCTGCACGCGATATG
CAAGATACCTTTTACATTTCAGATCCCAAGGCTGGCGAGAAGCCGCGCGCGCAAGTGCCCGGACAGGACGCAGAA
GCGTATTGGAACAATGTCAAACAAGTACACCAGGATGGCAAGTACGGCTCGATTGGATATCGGTATCCGTGGTCG
GCCGAGGAGTCGCTGAAGCTGGTGTTGCGTACTCACACCACCTCCGTCTCGGCGGCGTTGCTGCATAAACTCGCG
GCGACCAAAGGCGAGGATGGACGACCCAAACCAGCACGGTACTTTTCTATTGATCGCGTCTACCGTAACGAAACG
GTGGATGCGACGCACTTGGCCGAATTTCATCAAATCGAGGGTGTTATTGCCGATTATGGGCTGTCCCTTGGCGGC
CTGATGGAGTTTATGGAGATTTTCTTTGCCAAGATGGGTATCACAGACCTCAAGTTTAAGCCAGCTTATAACCCC
TATACGGAACCCAGTATGGAGATTTTTAGCTTCCACAAGGGTCTCAACAAGCTGGTCGAGATTGGCAACAGCGGC
ATGTTTCGGCCAGAGATGCTCGAGGCCATGGGGCTACCCAGCGACATGCGTATCTTTGGGTGGGGTCTGAGTCTG
GAACGGCCGACGATGATCAAGTACAAGATTTCCAACATTCGCGAGCTGCTTGGACACAAGGTCGACCTGGGCTTT
ATTGAGCGGAATCCTGCAGTAAGGTTTGAGCAGGAATAG
Gene >OphauB2|4931
ATGACGACCTCTAGCCCTGCTCCCGCAGGTGATCTTGCCACCCGCGTGCTGCAGGCTCTGTCGACACAGAGCCCC
ATTCAATCTGCCGATGCCTTTCCCAGCATTCCGTTTCAGGAGGTCAAAGGCGCTCTCGACCGGCTGGCATCACGG
TCCATGGTTACATACGAGACGATTGAGCGCGAGGAAGCACTCCTAGAACCCGAGGCAGAAACTATTGCCGCCCAT
GGAAGTCATGAGGCGCGAGTGTTTGAGGCCTTGAAGCAGGCCATGGACGGCCTGACTGTTCAGGAGCTGGAACAA
GTCATTGGAGACAAGAATGTTACCAAGCTTGGCCAAGGCAAGGCCTTTCGCGAGAAGTGGATATCCAAGAGCAAG
GATGGCAAACTTGTTGCTACTGTACGTCGTCTTTTGTACTGCTAGCCAGAGGCCGAGAATTGTTGAACTGATGGT
GAGCCAGGCTGAATCGATACAAGACGTCACCCGCGCCCAGTTACAACAAGTTAAAGAGTCGCGAACCGGCGATGT
CAAGGTTCTCAACGATCTCAAAAAGCGCAAGCTTATTCGCATGCAAAAGATTATTACTTTTAAAATCGCAAAGGG
TCCCAAATTTGCCCTTGAAATGCAAAAGGAAGAGACGGACCTCACGGCTGACATGCTCACGTCGGGATCATGGAA
AACGGCCACCTTTAAACCCTACAACTTCAAGGCTCTAGGAGCAGACCAGAACGCCGGTGCCTTGCATCCCCTGAA
CAAGGTGCGGCACGAGTTCCGCCAAATTTTCTTTGAAATGGGCTTTCAGGAAATGCCGACAAACAAGTTTGTCGA
GACGGGCTTCTGGAACTTTGACGCCCTCTATGTACCGCAGCAACATCCTGCACGCGATATGCAAGATACCTTTTA
CATTTCAGATCCCAAGGCTGGCGAGAAGCCGCGCGCGCAAGTGCCCGGACAGGACGCAGAAGCGTATTGGAACAA
TGTCAAACAAGTACACCAGGATGGCAAGTACGGCTCGATTGGATATCGGTATCCGTGGTCGGCCGAGGAGTCGCT
GAAGCTGGTGTTGCGTACTCACACCACCTCCGTCTCGGCGGCGTTGCTGCATAAACTCGCGGCGACCAAAGGCGA
GGATGGACGACCCAAACCAGCACGGTACTTTTCTATTGATCGCGTCTACCGTAACGAAACGGTGGATGCGACGCA
CTTGGCCGAATTTCATCAAATCGAGGGTGTTATTGCCGATTATGGGCTGTCCCTTGGCGGCCTGATGGAGTTTAT
GGAGATTTTCTTTGCCAAGATGGGTATCACAGACCTCAAGTTTAAGCCAGCTTATAACCCCTATACGGAACCCAG
TATGGAGATTTTTAGCTTCCACAAGGGTCTCAACAAGCTGGTCGAGATTGGCAACAGCGGCATGTTTCGGCCAGA
GATGCTCGAGGCCATGGGGCTACCCAGCGACATGCGTATCTTTGGGTGGGGTCTGAGTCTGGAACGGCCGACGAT
GATCAAGTACAAGATTTCCAACATTCGCGAGCTGCTTGGACACAAGGTCGACCTGGGCTTTATTGAGCGGAATCC
TGCAGTAAGGTTTGAGCAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail