Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4919
Gene name
LocationContig_35:66916..67708
Strand-
Gene length (bp)792
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 1.1E-08 5 223

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UQ73|YL509_MIMIV Uncharacterized protein L509 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L509 PE=4 SV=1 3 247 2.0E-13

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4919
MAIQIMSDLHLEAPRAYERFDITPRAPYLALLGDIGNVFSHWSEYRGFLVKMLMKFSLVLLVPGNHEPYHSDWPS
TLRTLSDFEDEVESLNSLGKFVLLDRVAHHLPREKTVILGCSLFSWISPANEPFVRRRLHDFTQIGDWDPPAHTD
AHVRDLVWLNLKVAELEQTDNKIIILTHWSPRRLCVDNVEPEPATSGFCTDLSEEACFKSPSVRLWAFGHTHNNC
DFVVRRGRDVPPLRVLANQRGYHFAQAGGFDAEKTVEL*
Coding >OphauB2|4919
ATGGCTATTCAAATCATGTCGGATTTACATCTAGAGGCGCCCAGGGCCTACGAACGTTTTGACATTACACCCAGA
GCACCGTATCTGGCTTTGCTTGGCGATATTGGCAATGTCTTTTCTCATTGGAGCGAATACCGCGGCTTTCTCGTC
AAGATGCTCATGAAGTTTAGTCTTGTCTTACTCGTCCCTGGAAACCACGAACCATACCACTCAGACTGGCCAAGC
ACTCTCAGAACGCTAAGTGACTTTGAAGACGAGGTTGAGAGCCTGAATTCTCTAGGGAAATTCGTCTTGCTCGAT
CGTGTGGCGCACCACCTCCCCCGTGAAAAGACGGTTATTCTAGGCTGCAGCCTATTTTCCTGGATCTCGCCCGCC
AACGAACCCTTTGTTCGAAGACGTCTTCATGACTTTACTCAGATTGGCGATTGGGATCCCCCGGCCCACACCGAT
GCCCATGTACGAGACCTCGTCTGGCTAAACTTGAAAGTGGCCGAGTTGGAGCAGACGGACAATAAAATCATCATC
TTGACACATTGGAGTCCGAGACGCCTTTGTGTCGACAATGTCGAACCGGAGCCCGCCACAAGTGGCTTTTGCACC
GACCTGTCTGAGGAGGCCTGCTTCAAGAGCCCAAGCGTGAGGCTTTGGGCGTTTGGCCACACACACAACAATTGC
GACTTTGTGGTTAGACGCGGTCGAGACGTGCCGCCTTTGCGAGTCTTGGCCAACCAGAGAGGCTACCACTTTGCT
CAGGCTGGCGGCTTTGATGCAGAAAAGACGGTGGAGCTCTAA
Transcript >OphauB2|4919
ATGGCTATTCAAATCATGTCGGATTTACATCTAGAGGCGCCCAGGGCCTACGAACGTTTTGACATTACACCCAGA
GCACCGTATCTGGCTTTGCTTGGCGATATTGGCAATGTCTTTTCTCATTGGAGCGAATACCGCGGCTTTCTCGTC
AAGATGCTCATGAAGTTTAGTCTTGTCTTACTCGTCCCTGGAAACCACGAACCATACCACTCAGACTGGCCAAGC
ACTCTCAGAACGCTAAGTGACTTTGAAGACGAGGTTGAGAGCCTGAATTCTCTAGGGAAATTCGTCTTGCTCGAT
CGTGTGGCGCACCACCTCCCCCGTGAAAAGACGGTTATTCTAGGCTGCAGCCTATTTTCCTGGATCTCGCCCGCC
AACGAACCCTTTGTTCGAAGACGTCTTCATGACTTTACTCAGATTGGCGATTGGGATCCCCCGGCCCACACCGAT
GCCCATGTACGAGACCTCGTCTGGCTAAACTTGAAAGTGGCCGAGTTGGAGCAGACGGACAATAAAATCATCATC
TTGACACATTGGAGTCCGAGACGCCTTTGTGTCGACAATGTCGAACCGGAGCCCGCCACAAGTGGCTTTTGCACC
GACCTGTCTGAGGAGGCCTGCTTCAAGAGCCCAAGCGTGAGGCTTTGGGCGTTTGGCCACACACACAACAATTGC
GACTTTGTGGTTAGACGCGGTCGAGACGTGCCGCCTTTGCGAGTCTTGGCCAACCAGAGAGGCTACCACTTTGCT
CAGGCTGGCGGCTTTGATGCAGAAAAGACGGTGGAGCTCTAA
Gene >OphauB2|4919
ATGGCTATTCAAATCATGTCGGATTTACATCTAGAGGCGCCCAGGGCCTACGAACGTTTTGACATTACACCCAGA
GCACCGTATCTGGCTTTGCTTGGCGATATTGGCAATGTCTTTTCTCATTGGAGCGAATACCGCGGCTTTCTCGTC
AAGATGCTCATGAAGTTTAGTCTTGTCTTACTCGTCCCTGGAAACCACGAACCATACCACTCAGACTGGCCAAGC
ACTCTCAGAACGCTAAGTGACTTTGAAGACGAGGTTGAGAGCCTGAATTCTCTAGGGAAATTCGTCTTGCTCGAT
CGTGTGGCGCACCACCTCCCCCGTGAAAAGACGGTTATTCTAGGCTGCAGCCTATTTTCCTGGATCTCGCCCGCC
AACGAACCCTTTGTTCGAAGACGTCTTCATGACTTTACTCAGATTGGCGATTGGGATCCCCCGGCCCACACCGAT
GCCCATGTACGAGACCTCGTCTGGCTAAACTTGAAAGTGGCCGAGTTGGAGCAGACGGACAATAAAATCATCATC
TTGACACATTGGAGTCCGAGACGCCTTTGTGTCGACAATGTCGAACCGGAGCCCGCCACAAGTGGCTTTTGCACC
GACCTGTCTGAGGAGGCCTGCTTCAAGAGCCCAAGCGTGAGGCTTTGGGCGTTTGGCCACACACACAACAATTGC
GACTTTGTGGTTAGACGCGGTCGAGACGTGCCGCCTTTGCGAGTCTTGGCCAACCAGAGAGGCTACCACTTTGCT
CAGGCTGGCGGCTTTGATGCAGAAAAGACGGTGGAGCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail