Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4918
Gene name
LocationContig_35:63005..65331
Strand+
Gene length (bp)2326
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 1.3E-70 192 415
PF00306 ATP-synt_ab_C ATP synthase alpha/beta chain, C terminal domain 3.5E-47 422 546
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 5.6E-14 69 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37211|ATPA_NEUCR ATP synthase subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-1 PE=3 SV=1 1 552 0.0E+00
sp|P49375|ATPA_KLULA ATP synthase subunit alpha, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP1 PE=1 SV=1 1 551 0.0E+00
sp|P07251|ATPA_YEAST ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP1 PE=1 SV=5 42 551 0.0E+00
sp|P24487|ATPA_SCHPO ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp1 PE=3 SV=1 38 551 0.0E+00
sp|P19483|ATPA_BOVIN ATP synthase subunit alpha, mitochondrial OS=Bos taurus GN=ATP5A1 PE=1 SV=1 45 551 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37211|ATPA_NEUCR ATP synthase subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-1 PE=3 SV=1 1 552 0.0E+00
sp|P49375|ATPA_KLULA ATP synthase subunit alpha, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP1 PE=1 SV=1 1 551 0.0E+00
sp|P07251|ATPA_YEAST ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP1 PE=1 SV=5 42 551 0.0E+00
sp|P24487|ATPA_SCHPO ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp1 PE=3 SV=1 38 551 0.0E+00
sp|P19483|ATPA_BOVIN ATP synthase subunit alpha, mitochondrial OS=Bos taurus GN=ATP5A1 PE=1 SV=1 45 551 0.0E+00
sp|Q03265|ATPA_MOUSE ATP synthase subunit alpha, mitochondrial OS=Mus musculus GN=Atp5a1 PE=1 SV=1 45 551 0.0E+00
sp|P80021|ATPA_PIG ATP synthase subunit alpha, mitochondrial OS=Sus scrofa GN=ATP5A1 PE=1 SV=2 45 551 0.0E+00
sp|Q5R546|ATPA_PONAB ATP synthase subunit alpha, mitochondrial OS=Pongo abelii GN=ATP5A1 PE=2 SV=1 45 551 0.0E+00
sp|A5A6H5|ATPA_PANTR ATP synthase subunit alpha, mitochondrial OS=Pan troglodytes GN=ATP5A1 PE=2 SV=1 45 551 0.0E+00
sp|P25705|ATPA_HUMAN ATP synthase subunit alpha, mitochondrial OS=Homo sapiens GN=ATP5A1 PE=1 SV=1 45 551 0.0E+00
sp|P15999|ATPA_RAT ATP synthase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Atp5a1 PE=1 SV=2 45 551 0.0E+00
sp|Q9XXK1|ATPA_CAEEL ATP synthase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=H28O16.1 PE=1 SV=1 44 551 0.0E+00
sp|P08428|ATPA_XENLA ATP synthase subunit alpha, mitochondrial OS=Xenopus laevis GN=atp5a PE=2 SV=1 45 551 0.0E+00
sp|P35381|ATPA_DROME ATP synthase subunit alpha, mitochondrial OS=Drosophila melanogaster GN=blw PE=1 SV=2 50 551 0.0E+00
sp|C3M9S3|ATPA_RHISN ATP synthase subunit alpha OS=Rhizobium sp. (strain NGR234) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A5V3X3|ATPA_SPHWW ATP synthase subunit alpha OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q92LK6|ATPA_RHIME ATP synthase subunit alpha OS=Rhizobium meliloti (strain 1021) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A6UDM3|ATPA_SINMW ATP synthase subunit alpha OS=Sinorhizobium medicae (strain WSM419) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q2N8Z5|ATPA_ERYLH ATP synthase subunit alpha OS=Erythrobacter litoralis (strain HTCC2594) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q8UC74|ATPA_AGRFC ATP synthase subunit alpha OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q0BQE6|ATPA_GRABC ATP synthase subunit alpha OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q5NQZ1|ATPA_ZYMMO ATP synthase subunit alpha OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q1MAZ0|ATPA_RHIL3 ATP synthase subunit alpha OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q2G5N7|ATPA_NOVAD ATP synthase subunit alpha OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B5ZSN9|ATPA_RHILW ATP synthase subunit alpha OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q98EV6|ATPA_RHILO ATP synthase subunit alpha OS=Rhizobium loti (strain MAFF303099) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A7IH29|ATPA_XANP2 ATP synthase subunit alpha OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q57B86|ATPA_BRUAB ATP synthase subunit alpha OS=Brucella abortus biovar 1 (strain 9-941) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q2YLI5|ATPA_BRUA2 ATP synthase subunit alpha OS=Brucella abortus (strain 2308) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B2S7M5|ATPA_BRUA1 ATP synthase subunit alpha OS=Brucella abortus (strain S19) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q2VZN0|ATPA_MAGSA ATP synthase subunit alpha OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A8HS15|ATPA_AZOC5 ATP synthase subunit alpha OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A9WWS4|ATPA_BRUSI ATP synthase subunit alpha OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A9M839|ATPA_BRUC2 ATP synthase subunit alpha OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q2K3G8|ATPA_RHIEC ATP synthase subunit alpha OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q8YJ37|ATPA_BRUME ATP synthase subunit alpha OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|C0RF52|ATPA_BRUMB ATP synthase subunit alpha OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A7HT50|ATPA_PARL1 ATP synthase subunit alpha OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q11DD7|ATPA_CHESB ATP synthase subunit alpha OS=Chelativorans sp. (strain BNC1) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B0UE41|ATPA_METS4 ATP synthase subunit alpha OS=Methylobacterium sp. (strain 4-46) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B3PQ70|ATPA_RHIE6 ATP synthase subunit alpha OS=Rhizobium etli (strain CIAT 652) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q8FYR3|ATPA_BRUSU ATP synthase subunit alpha OS=Brucella suis biovar 1 (strain 1330) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A5VSE3|ATPA_BRUO2 ATP synthase subunit alpha OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q2J3I2|ATPA_RHOP2 ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain HaA2) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B8IN03|ATPA_METNO ATP synthase subunit alpha OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q13DP4|ATPA_RHOPS ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB5) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B8EQP9|ATPA_METSB ATP synthase subunit alpha OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q21CY5|ATPA_RHOPB ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB18) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q4FP36|ATPA_PELUB ATP synthase subunit alpha OS=Pelagibacter ubique (strain HTCC1062) GN=atpA PE=3 SV=1 47 553 0.0E+00
sp|B1ZEE9|ATPA_METPB ATP synthase subunit alpha OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A6WXW9|ATPA_OCHA4 ATP synthase subunit alpha OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q6NDD0|ATPA_RHOPA ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q1QQS5|ATPA_NITHX ATP synthase subunit alpha OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q07UZ3|ATPA_RHOP5 ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisA53) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A5FZ52|ATPA_ACICJ ATP synthase subunit alpha OS=Acidiphilium cryptum (strain JF-5) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q28TJ8|ATPA_JANSC ATP synthase subunit alpha OS=Jannaschia sp. (strain CCS1) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A9W2R3|ATPA_METEP ATP synthase subunit alpha OS=Methylobacterium extorquens (strain PA1) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B7KUA4|ATPA_METC4 ATP synthase subunit alpha OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B1LVH1|ATPA_METRJ ATP synthase subunit alpha OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A5E948|ATPA_BRASB ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B6JD06|ATPA_OLICO ATP synthase subunit alpha OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q1GEU6|ATPA_RUEST ATP synthase subunit alpha OS=Ruegeria sp. (strain TM1040) GN=atpA PE=3 SV=1 50 545 0.0E+00
sp|B9JTR4|ATPA_AGRVS ATP synthase subunit alpha OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q89X72|ATPA_BRADU ATP synthase subunit alpha OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A8LJR6|ATPA2_DINSH ATP synthase subunit alpha 2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpA2 PE=3 SV=1 50 547 0.0E+00
sp|A4YKD8|ATPA_BRASO ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain ORS278) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q1GQS7|ATPA_SPHAL ATP synthase subunit alpha OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B9KPI6|ATPA_RHOSK ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=atpA PE=3 SV=1 50 526 0.0E+00
sp|Q3J433|ATPA_RHOS4 ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpA PE=3 SV=1 50 526 0.0E+00
sp|A3PIB7|ATPA1_RHOS1 ATP synthase subunit alpha 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpA1 PE=3 SV=1 50 526 0.0E+00
sp|B0T338|ATPA_CAUSK ATP synthase subunit alpha OS=Caulobacter sp. (strain K31) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q3SVJ4|ATPA_NITWN ATP synthase subunit alpha OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A4WUM9|ATPA_RHOS5 ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpA PE=3 SV=1 50 526 0.0E+00
sp|Q5LNN9|ATPA_RUEPO ATP synthase subunit alpha OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A1UR47|ATPA_BARBK ATP synthase subunit alpha OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|P26854|ATPAM_MARPO ATP synthase subunit alpha, mitochondrial OS=Marchantia polymorpha GN=ATPA PE=3 SV=2 45 553 0.0E+00
sp|P72245|ATPA_RHOCA ATP synthase subunit alpha OS=Rhodobacter capsulatus GN=atpA PE=1 SV=3 50 551 0.0E+00
sp|Q162S7|ATPA_ROSDO ATP synthase subunit alpha OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q9A2V7|ATPA_CAUCR ATP synthase subunit alpha OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B8H5I2|ATPA_CAUCN ATP synthase subunit alpha OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|P05439|ATPA_RHOBL ATP synthase subunit alpha OS=Rhodobacter blasticus GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A1B8N8|ATPA_PARDP ATP synthase subunit alpha OS=Paracoccus denitrificans (strain Pd 1222) GN=atpA PE=1 SV=1 50 540 0.0E+00
sp|Q0AKV8|ATPA_MARMM ATP synthase subunit alpha OS=Maricaulis maris (strain MCS10) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|P05036|ATPA_RHORU ATP synthase subunit alpha OS=Rhodospirillum rubrum GN=atpA PE=1 SV=1 50 551 0.0E+00
sp|Q2RV20|ATPA_RHORT ATP synthase subunit alpha OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q6G1W7|ATPA_BARHE ATP synthase subunit alpha OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B4RD45|ATPA_PHEZH ATP synthase subunit alpha OS=Phenylobacterium zucineum (strain HLK1) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q6FYM1|ATPA_BARQU ATP synthase subunit alpha OS=Bartonella quintana (strain Toulouse) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A9IYX0|ATPA_BART1 ATP synthase subunit alpha OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q0C0Z8|ATPA_HYPNA ATP synthase subunit alpha OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|P05493|ATPAM_PEA ATP synthase subunit alpha, mitochondrial OS=Pisum sativum GN=ATPA PE=3 SV=2 50 542 0.0E+00
sp|Q5FRC7|ATPA1_GLUOX ATP synthase subunit alpha 1 OS=Gluconobacter oxydans (strain 621H) GN=atpA1 PE=3 SV=1 48 551 0.0E+00
sp|A8GTS8|ATPA_RICRS ATP synthase subunit alpha OS=Rickettsia rickettsii (strain Sheila Smith) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|B0BVB8|ATPA_RICRO ATP synthase subunit alpha OS=Rickettsia rickettsii (strain Iowa) GN=atpA PE=3 SV=2 45 552 0.0E+00
sp|Q01915|ATPAM_SOYBN ATP synthase subunit alpha, mitochondrial OS=Glycine max GN=ATPA PE=3 SV=1 50 534 0.0E+00
sp|Q4UK16|ATPA_RICFE ATP synthase subunit alpha OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|A9H9A4|ATPA_GLUDA ATP synthase subunit alpha OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|P0C522|ATPAM_ORYSJ ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=ATPA PE=1 SV=1 50 549 0.0E+00
sp|P0C521|ATPAM_ORYSI ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica GN=ATPA PE=3 SV=1 50 549 0.0E+00
sp|P0C520|ATPAM_ORYSA ATP synthase subunit alpha, mitochondrial OS=Oryza sativa GN=ATPA PE=3 SV=1 50 549 0.0E+00
sp|P24459|ATPAM_PHAVU ATP synthase subunit alpha, mitochondrial OS=Phaseolus vulgaris GN=ATPA PE=3 SV=1 50 534 0.0E+00
sp|A8F2U2|ATPA_RICM5 ATP synthase subunit alpha OS=Rickettsia massiliae (strain Mtu5) GN=atpA PE=3 SV=2 45 552 0.0E+00
sp|P05492|ATPAM_OENBI ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis GN=ATPA PE=3 SV=1 50 549 0.0E+00
sp|C4K229|ATPA_RICPU ATP synthase subunit alpha OS=Rickettsia peacockii (strain Rustic) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|A8GY42|ATPA_RICB8 ATP synthase subunit alpha OS=Rickettsia bellii (strain OSU 85-389) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|Q92G86|ATPA_RICCN ATP synthase subunit alpha OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=atpA PE=3 SV=2 45 552 0.0E+00
sp|P05494|ATPAM_MAIZE ATP synthase subunit alpha, mitochondrial OS=Zea mays GN=ATPA PE=3 SV=1 50 542 0.0E+00
sp|A0LDA2|ATPA_MAGMM ATP synthase subunit alpha OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=atpA PE=3 SV=1 45 553 0.0E+00
sp|A8GPZ6|ATPA_RICAH ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|P92549|ATPAM_ARATH ATP synthase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=ATPA PE=1 SV=2 50 548 0.0E+00
sp|P18260|ATPAM_HELAN ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus GN=ATPA PE=3 SV=1 50 542 0.0E+00
sp|Q06735|ATPAM_BETVU ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris GN=ATPA PE=3 SV=1 50 508 0.0E+00
sp|P12862|ATPAM_WHEAT ATP synthase subunit alpha, mitochondrial OS=Triticum aestivum GN=ATPA PE=3 SV=1 50 548 0.0E+00
sp|P05495|ATPAM_NICPL ATP synthase subunit alpha, mitochondrial OS=Nicotiana plumbaginifolia GN=ATPA PE=3 SV=1 50 548 0.0E+00
sp|O50288|ATPA_RICPR ATP synthase subunit alpha OS=Rickettsia prowazekii (strain Madrid E) GN=atpA PE=3 SV=2 45 551 0.0E+00
sp|P68541|ATPAM_RAPSA ATP synthase subunit alpha, mitochondrial OS=Raphanus sativus GN=ATPA PE=3 SV=1 50 548 0.0E+00
sp|P68542|ATPAM_BRACM ATP synthase subunit alpha, mitochondrial OS=Brassica campestris GN=ATPA PE=3 SV=1 50 548 0.0E+00
sp|P22201|ATPAM_BRANA ATP synthase subunit alpha, mitochondrial OS=Brassica napus GN=ATPA PE=3 SV=1 50 542 0.0E+00
sp|Q68VU6|ATPA_RICTY ATP synthase subunit alpha OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|B0THN4|ATPA_HELMI ATP synthase subunit alpha OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A8F006|ATPA_RICCK ATP synthase subunit alpha OS=Rickettsia canadensis (strain McKiel) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|B9LZ86|ATPA_GEODF ATP synthase subunit alpha OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q39Q54|ATPA_GEOMG ATP synthase subunit alpha OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q74GY2|ATPA_GEOSL ATP synthase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=atpA PE=3 SV=1 50 540 0.0E+00
sp|B3EA03|ATPA_GEOLS ATP synthase subunit alpha OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A5G9D6|ATPA_GEOUR ATP synthase subunit alpha OS=Geobacter uraniireducens (strain Rf4) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|C6E9F3|ATPA_GEOSM ATP synthase subunit alpha OS=Geobacter sp. (strain M21) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q3A944|ATPA_CARHZ ATP synthase subunit alpha OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B5EFI9|ATPA_GEOBB ATP synthase subunit alpha OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q39ZT9|ATPA1_PELCD ATP synthase subunit alpha 1/3 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpA1 PE=3 SV=1 43 551 0.0E+00
sp|A1ALL5|ATPA_PELPD ATP synthase subunit alpha OS=Pelobacter propionicus (strain DSM 2379) GN=atpA1 PE=3 SV=1 45 551 0.0E+00
sp|B4U989|ATPA_HYDS0 ATP synthase subunit alpha OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=atpA PE=3 SV=1 54 552 0.0E+00
sp|A6TK63|ATPA_ALKMQ ATP synthase subunit alpha OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q2IHQ9|ATPA_ANADE ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|B8FGT6|ATPA_DESAA ATP synthase subunit alpha OS=Desulfatibacillum alkenivorans (strain AK-01) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B3CSS9|ATPA_ORITI ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Ikeda) GN=atpA PE=3 SV=1 49 551 0.0E+00
sp|B8JCV2|ATPA_ANAD2 ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|Q1CWT2|ATPA_MYXXD ATP synthase subunit alpha OS=Myxococcus xanthus (strain DK 1622) GN=atpA PE=3 SV=2 50 512 0.0E+00
sp|Q07405|ATPA_MYXXA ATP synthase subunit alpha OS=Myxococcus xanthus GN=atpA PE=1 SV=1 50 512 0.0E+00
sp|B4UKF2|ATPA_ANASK ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain K) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|A8MJW1|ATPA_ALKOO ATP synthase subunit alpha OS=Alkaliphilus oremlandii (strain OhILAs) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A0LLG0|ATPA_SYNFM ATP synthase subunit alpha OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A7HIX9|ATPA_ANADF ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|B8CZ12|ATPA_HALOH ATP synthase subunit alpha OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A8ZU99|ATPA_DESOH ATP synthase subunit alpha OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=atpA PE=3 SV=1 50 534 0.0E+00
sp|A6Q4C2|ATPA_NITSB ATP synthase subunit alpha OS=Nitratiruptor sp. (strain SB155-2) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|B5YI22|ATPA_THEYD ATP synthase subunit alpha OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q313V8|ATPA_DESAG ATP synthase subunit alpha OS=Desulfovibrio alaskensis (strain G20) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A5CD07|ATPA_ORITB ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Boryong) GN=atpA PE=3 SV=1 49 551 0.0E+00
sp|A8F3K0|ATPA_PSELT ATP synthase subunit alpha OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|Q24MN9|ATPA_DESHY ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain Y51) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q7VJ23|ATPA_HELHP ATP synthase subunit alpha OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|A1BJF5|ATPA_CHLPD ATP synthase subunit alpha OS=Chlorobium phaeobacteroides (strain DSM 266) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B7IG42|ATPA_THEAB ATP synthase subunit alpha OS=Thermosipho africanus (strain TCF52B) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|B8DRD0|ATPA_DESVM ATP synthase subunit alpha OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B8FZ36|ATPA_DESHD ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q2LQZ7|ATPA1_SYNAS ATP synthase subunit alpha 1 OS=Syntrophus aciditrophicus (strain SB) GN=atpA1 PE=3 SV=1 50 553 0.0E+00
sp|Q8KAW8|ATPA_CHLTE ATP synthase subunit alpha OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q3AUA7|ATPA_CHLCH ATP synthase subunit alpha OS=Chlorobium chlorochromatii (strain CaD3) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q67TB9|ATPA_SYMTH ATP synthase subunit alpha OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpA PE=3 SV=1 48 545 0.0E+00
sp|C5CIV6|ATPA_KOSOT ATP synthase subunit alpha OS=Kosmotoga olearia (strain TBF 19.5.1) GN=atpA PE=3 SV=1 45 553 0.0E+00
sp|B8J437|ATPA_DESDA ATP synthase subunit alpha OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|B9DX63|ATPA_CLOK1 ATP synthase subunit alpha OS=Clostridium kluyveri (strain NBRC 12016) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q30QP9|ATPA_SULDN ATP synthase subunit alpha OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=atpA PE=3 SV=1 44 552 0.0E+00
sp|Q180W8|ATPA_PEPD6 ATP synthase subunit alpha OS=Peptoclostridium difficile (strain 630) GN=atpA PE=3 SV=1 48 548 0.0E+00
sp|A5CYE4|ATPA_PELTS ATP synthase subunit alpha OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B4SGC7|ATPA_PELPB ATP synthase subunit alpha OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A1VFJ3|ATPA_DESVV ATP synthase subunit alpha OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q72E02|ATPA_DESVH ATP synthase subunit alpha OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A6LJR3|ATPA_THEM4 ATP synthase subunit alpha OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|Q2RFX7|ATPA_MOOTA ATP synthase subunit alpha OS=Moorella thermoacetica (strain ATCC 39073) GN=atpA PE=1 SV=1 48 551 0.0E+00
sp|A5N3H9|ATPA_CLOK5 ATP synthase subunit alpha OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|A8EV72|ATPA_ARCB4 ATP synthase subunit alpha OS=Arcobacter butzleri (strain RM4018) GN=atpA PE=3 SV=1 44 551 0.0E+00
sp|Q8RGE0|ATPA_FUSNN ATP synthase subunit alpha OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q6MGM5|ATPA_BDEBA ATP synthase subunit alpha OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpA PE=3 SV=1 50 540 0.0E+00
sp|A4SGM9|ATPA_CHLPM ATP synthase subunit alpha OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B1LBC1|ATPA_THESQ ATP synthase subunit alpha OS=Thermotoga sp. (strain RQ2) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|A5ILX0|ATPA_THEP1 ATP synthase subunit alpha OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|Q9X1U7|ATPA_THEMA ATP synthase subunit alpha OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=atpA PE=1 SV=1 45 551 0.0E+00
sp|B9K7T9|ATPA_THENN ATP synthase subunit alpha OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|O66907|ATPA_AQUAE ATP synthase subunit alpha OS=Aquifex aeolicus (strain VF5) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A7ZC35|ATPA_CAMC1 ATP synthase subunit alpha OS=Campylobacter concisus (strain 13826) GN=atpA PE=3 SV=1 44 551 0.0E+00
sp|B3EL39|ATPA_CHLPB ATP synthase subunit alpha OS=Chlorobium phaeobacteroides (strain BS1) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q5HC95|ATPA_EHRRW ATP synthase subunit alpha OS=Ehrlichia ruminantium (strain Welgevonden) GN=atpA PE=3 SV=1 47 534 0.0E+00
sp|Q5FF66|ATPA_EHRRG ATP synthase subunit alpha OS=Ehrlichia ruminantium (strain Gardel) GN=atpA PE=3 SV=1 47 534 0.0E+00
sp|B3EHU6|ATPA_CHLL2 ATP synthase subunit alpha OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A0RR28|ATPA_CAMFF ATP synthase subunit alpha OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=atpA PE=3 SV=1 45 547 0.0E+00
sp|Q2JIG0|ATPA_SYNJB ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q02BU3|ATPA_SOLUE ATP synthase subunit alpha OS=Solibacter usitatus (strain Ellin6076) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q5WB76|ATPA_BACSK ATP synthase subunit alpha OS=Bacillus clausii (strain KSM-K16) GN=atpA PE=3 SV=1 44 553 0.0E+00
sp|B2J058|ATPA_NOSP7 ATP synthase subunit alpha OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q2GHX3|ATPA_EHRCR ATP synthase subunit alpha OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=atpA PE=3 SV=1 47 526 0.0E+00
sp|Q9K6H3|ATPA_BACHD ATP synthase subunit alpha OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q6AQ12|ATPA_DESPS ATP synthase subunit alpha OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q3YT21|ATPA_EHRCJ ATP synthase subunit alpha OS=Ehrlichia canis (strain Jake) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|Q2JSW1|ATPA_SYNJA ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q1ACM8|ATPA_CHAVU ATP synthase subunit alpha, chloroplastic OS=Chara vulgaris GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q3B1F4|ATPA2_CHLL7 ATP synthase subunit alpha 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpA2 PE=3 SV=1 48 551 0.0E+00
sp|B0BZL2|ATPA1_ACAM1 ATP synthase subunit alpha 1 OS=Acaryochloris marina (strain MBIC 11017) GN=atpA1 PE=3 SV=1 48 553 0.0E+00
sp|Q0SQZ3|ATPA_CLOPS ATP synthase subunit alpha OS=Clostridium perfringens (strain SM101 / Type A) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q8XID2|ATPA_CLOPE ATP synthase subunit alpha OS=Clostridium perfringens (strain 13 / Type A) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q0TNC2|ATPA_CLOP1 ATP synthase subunit alpha OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|A7I175|ATPA_CAMHC ATP synthase subunit alpha OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=atpA PE=3 SV=1 44 551 0.0E+00
sp|B2A3G4|ATPA_NATTJ ATP synthase subunit alpha OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=atpA PE=3 SV=1 48 543 0.0E+00
sp|Q11YP1|ATPA_CYTH3 ATP synthase subunit alpha OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=atpA PE=3 SV=1 48 543 0.0E+00
sp|B2UUP2|ATPA_HELPS ATP synthase subunit alpha OS=Helicobacter pylori (strain Shi470) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|Q7MA20|ATPA_WOLSU ATP synthase subunit alpha OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|A4J9A1|ATPA_DESRM ATP synthase subunit alpha OS=Desulfotomaculum reducens (strain MI-1) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A7H019|ATPA_CAMC5 ATP synthase subunit alpha OS=Campylobacter curvus (strain 525.92) GN=atpA PE=3 SV=1 44 551 0.0E+00
sp|Q1CSD3|ATPA_HELPH ATP synthase subunit alpha OS=Helicobacter pylori (strain HPAG1) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|B5Z8D2|ATPA_HELPG ATP synthase subunit alpha OS=Helicobacter pylori (strain G27) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|P55987|ATPA_HELPY ATP synthase subunit alpha OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|B6JMX4|ATPA_HELP2 ATP synthase subunit alpha OS=Helicobacter pylori (strain P12) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|P56294|ATPA_CHLVU ATP synthase subunit alpha, chloroplastic OS=Chlorella vulgaris GN=atpA PE=3 SV=1 45 553 0.0E+00
sp|P29706|ATPA_PROMO ATP synthase subunit alpha, sodium ion specific OS=Propionigenium modestum GN=atpA PE=1 SV=2 45 551 0.0E+00
sp|Q05372|ATPA_SYNP1 ATP synthase subunit alpha OS=Synechococcus sp. (strain PCC 6716) GN=atpA PE=1 SV=4 48 551 0.0E+00
sp|Q9ZK79|ATPA_HELPJ ATP synthase subunit alpha OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|C1D5G4|ATPA_LARHH ATP synthase subunit alpha OS=Laribacter hongkongensis (strain HLHK9) GN=atpA PE=3 SV=1 47 547 0.0E+00
sp|Q8DLP3|ATPA_THEEB ATP synthase subunit alpha OS=Thermosynechococcus elongatus (strain BP-1) GN=atpA PE=1 SV=1 48 551 0.0E+00
sp|P22477|ATPA_BACPE ATP synthase subunit alpha OS=Bacillus pseudofirmus (strain OF4) GN=atpA PE=3 SV=2 48 551 0.0E+00
sp|Q0AUD1|ATPA_SYNWW ATP synthase subunit alpha OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|P17674|ATPA_BACMQ ATP synthase subunit alpha OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q8CNJ5|ATPA_STAES ATP synthase subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q5HMB7|ATPA_STAEQ ATP synthase subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|A7HJV9|ATPA_FERNB ATP synthase subunit alpha OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|Q9Z689|ATPA_CLOAB ATP synthase subunit alpha OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|C4KYS5|ATPA_EXISA ATP synthase subunit alpha OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|C0Z778|ATPA_BREBN ATP synthase subunit alpha OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpA PE=3 SV=1 48 526 0.0E+00
sp|Q5HX61|ATPA_CAMJR ATP synthase subunit alpha OS=Campylobacter jejuni (strain RM1221) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|A1VXI8|ATPA_CAMJJ ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|Q9PJ21|ATPA_CAMJE ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|A8FJR0|ATPA_CAMJ8 ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|B3QWX7|ATPA_CHLT3 ATP synthase subunit alpha OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B7K5I8|ATPA_CYAP8 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 8801) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q1MRB9|ATPA_LAWIP ATP synthase subunit alpha OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B8HPK1|ATPA_CYAP4 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q7U8W5|ATPA_SYNPX ATP synthase subunit alpha OS=Synechococcus sp. (strain WH8102) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A6QB61|ATPA_SULNB ATP synthase subunit alpha OS=Sulfurovum sp. (strain NBC37-1) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|Q8S8Y3|ATPA_ATRBE ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B2UZJ8|ATPA_CLOBA ATP synthase subunit alpha OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|A7Z9Q2|ATPA_BACMF ATP synthase subunit alpha OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|Q17Y80|ATPA_HELAH ATP synthase subunit alpha OS=Helicobacter acinonychis (strain Sheeba) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|P27179|ATPA_SYNY3 ATP synthase subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A0Q2Z6|ATPA_CLONN ATP synthase subunit alpha OS=Clostridium novyi (strain NT) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q06GS5|ATPA_PIPCE ATP synthase subunit alpha, chloroplastic OS=Piper cenocladum GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q6EW63|ATPA_NYMAL ATP synthase subunit alpha, chloroplastic OS=Nymphaea alba GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|P08449|ATPA_SYNP6 ATP synthase subunit alpha OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q0I7R2|ATPA_SYNS3 ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9311) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|B7KKR4|ATPA_CYAP7 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 7424) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B2TJZ8|ATPA_CLOBB ATP synthase subunit alpha OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q31RF1|ATPA_SYNE7 ATP synthase subunit alpha OS=Synechococcus elongatus (strain PCC 7942) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q1AVH7|ATPA_RUBXD ATP synthase subunit alpha OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|Q65DX2|ATPA_BACLD ATP synthase subunit alpha OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|A6LQH4|ATPA_CLOB8 ATP synthase subunit alpha OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|C4XI08|ATPA_DESMR ATP synthase subunit alpha OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=atpA PE=3 SV=1 68 551 0.0E+00
sp|Q0VKX2|ATPA_ALCBS ATP synthase subunit alpha OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=atpA PE=3 SV=1 47 547 0.0E+00
sp|P63676|ATPA_STAAW ATP synthase subunit alpha OS=Staphylococcus aureus (strain MW2) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|A8YY72|ATPA_STAAT ATP synthase subunit alpha OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q6G7K5|ATPA_STAAS ATP synthase subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q6GEX0|ATPA_STAAR ATP synthase subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|P99111|ATPA_STAAN ATP synthase subunit alpha OS=Staphylococcus aureus (strain N315) GN=atpA PE=1 SV=1 50 550 0.0E+00
sp|P63675|ATPA_STAAM ATP synthase subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|A5IUQ0|ATPA_STAA9 ATP synthase subunit alpha OS=Staphylococcus aureus (strain JH9) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q2FWE8|ATPA_STAA8 ATP synthase subunit alpha OS=Staphylococcus aureus (strain NCTC 8325) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q2FF22|ATPA_STAA3 ATP synthase subunit alpha OS=Staphylococcus aureus (strain USA300) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|A6U3J0|ATPA_STAA2 ATP synthase subunit alpha OS=Staphylococcus aureus (strain JH1) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|A7X4U5|ATPA_STAA1 ATP synthase subunit alpha OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q3AZM1|ATPA_SYNS9 ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9902) GN=atpA PE=3 SV=1 48 541 0.0E+00
sp|Q2YUJ9|ATPA_STAAB ATP synthase subunit alpha OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|B2KEX0|ATPA_ELUMP ATP synthase subunit alpha OS=Elusimicrobium minutum (strain Pei191) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B2V6N6|ATPA_SULSY ATP synthase subunit alpha OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|B3CN53|ATPA_WOLPP ATP synthase subunit alpha OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpA PE=3 SV=1 49 551 0.0E+00
sp|A7H1H9|ATPA_CAMJD ATP synthase subunit alpha OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|P06450|ATPA_SPIOL ATP synthase subunit alpha, chloroplastic OS=Spinacia oleracea GN=atpA PE=1 SV=1 50 552 0.0E+00
sp|Q2GIG2|ATPA_ANAPZ ATP synthase subunit alpha OS=Anaplasma phagocytophilum (strain HZ) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|A9L981|ATPA_LEMMI ATP synthase subunit alpha, chloroplastic OS=Lemna minor GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A6QIU9|ATPA_STAAE ATP synthase subunit alpha OS=Staphylococcus aureus (strain Newman) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|Q5HE95|ATPA_STAAC ATP synthase subunit alpha OS=Staphylococcus aureus (strain COL) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|A7GV58|ATPA_BACCN ATP synthase subunit alpha OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q1KXW5|ATPA_HELAN ATP synthase subunit alpha, chloroplastic OS=Helianthus annuus GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|B9L1H1|ATPA_THERP ATP synthase subunit alpha OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|C5D992|ATPA_GEOSW ATP synthase subunit alpha OS=Geobacillus sp. (strain WCH70) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|C0R2Y2|ATPA_WOLWR ATP synthase subunit alpha OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpA PE=3 SV=1 49 551 0.0E+00
sp|A5WBV9|ATPA_PSYWF ATP synthase subunit alpha OS=Psychrobacter sp. (strain PRwf-1) GN=atpA PE=3 SV=1 47 550 0.0E+00
sp|A8SE59|ATPA_CERDE ATP synthase subunit alpha, chloroplastic OS=Ceratophyllum demersum GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|O78475|ATPA_GUITH ATP synthase subunit alpha, chloroplastic OS=Guillardia theta GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|A4QJI4|ATPA_AETGR ATP synthase subunit alpha, chloroplastic OS=Aethionema grandiflorum GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q8EM81|ATPA_OCEIH ATP synthase subunit alpha OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q71WP7|ATPA2_LISMF ATP synthase subunit alpha 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=atpA2 PE=3 SV=1 50 550 0.0E+00
sp|Q112Z6|ATPA_TRIEI ATP synthase subunit alpha OS=Trichodesmium erythraeum (strain IMS101) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q223D4|ATPA1_RHOFT ATP synthase subunit alpha 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=atpA1 PE=3 SV=1 47 551 0.0E+00
sp|Q9MUT2|ATPA_MESVI ATP synthase subunit alpha, chloroplastic OS=Mesostigma viride GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|A4ITJ1|ATPA_GEOTN ATP synthase subunit alpha OS=Geobacillus thermodenitrificans (strain NG80-2) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q27S65|ATPA_SOLTU ATP synthase subunit alpha, chloroplastic OS=Solanum tuberosum GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q2MIB5|ATPA_SOLLC ATP synthase subunit alpha, chloroplastic OS=Solanum lycopersicum GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q2MIK2|ATPA_SOLBU ATP synthase subunit alpha, chloroplastic OS=Solanum bulbocastanum GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q20EV9|ATPA_OLTVI ATP synthase subunit alpha, chloroplastic OS=Oltmannsiellopsis viridis GN=atpA PE=3 SV=1 45 542 0.0E+00
sp|P37808|ATPA_BACSU ATP synthase subunit alpha OS=Bacillus subtilis (strain 168) GN=atpA PE=1 SV=3 50 551 0.0E+00
sp|Q3C1H4|ATPA_NICSY ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|A1XGM3|ATPA_RANMC ATP synthase subunit alpha, chloroplastic OS=Ranunculus macranthus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|P00823|ATPA_TOBAC ATP synthase subunit alpha, chloroplastic OS=Nicotiana tabacum GN=atpA PE=2 SV=2 50 542 0.0E+00
sp|A9VSA5|ATPA_BACWK ATP synthase subunit alpha OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q9TM26|ATPA_CYACA ATP synthase subunit alpha, chloroplastic OS=Cyanidium caldarium GN=atpA PE=3 SV=1 48 504 0.0E+00
sp|Q4L7Y6|ATPA_STAHJ ATP synthase subunit alpha OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|A4QJA0|ATPA_AETCO ATP synthase subunit alpha, chloroplastic OS=Aethionema cordifolium GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q7V037|ATPA_PROMP ATP synthase subunit alpha OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A4QKR6|ATPA_CRUWA ATP synthase subunit alpha, chloroplastic OS=Crucihimalaya wallichii GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q33C53|ATPA_NICTO ATP synthase subunit alpha, chloroplastic OS=Nicotiana tomentosiformis GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|B7IQW0|ATPA_BACC2 ATP synthase subunit alpha OS=Bacillus cereus (strain G9842) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q6HAX7|ATPA_BACHK ATP synthase subunit alpha OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q630U1|ATPA_BACCZ ATP synthase subunit alpha OS=Bacillus cereus (strain ZK / E33L) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|B9IRT9|ATPA_BACCQ ATP synthase subunit alpha OS=Bacillus cereus (strain Q1) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|B7HY67|ATPA_BACC7 ATP synthase subunit alpha OS=Bacillus cereus (strain AH187) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|C1F0N0|ATPA_BACC3 ATP synthase subunit alpha OS=Bacillus cereus (strain 03BB102) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q72XE6|ATPA_BACC1 ATP synthase subunit alpha OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|B7JGN2|ATPA_BACC0 ATP synthase subunit alpha OS=Bacillus cereus (strain AH820) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q81JZ3|ATPA_BACAN ATP synthase subunit alpha OS=Bacillus anthracis GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|A0RL97|ATPA_BACAH ATP synthase subunit alpha OS=Bacillus thuringiensis (strain Al Hakam) GN=atpA PE=3 SV=2 50 553 0.0E+00
sp|C3LFI1|ATPA_BACAC ATP synthase subunit alpha OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|C3P1F6|ATPA_BACAA ATP synthase subunit alpha OS=Bacillus anthracis (strain A0248) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|Q5KUJ1|ATPA_GEOKA ATP synthase subunit alpha OS=Geobacillus kaustophilus (strain HTA426) GN=atpA PE=1 SV=1 50 552 0.0E+00
sp|B1NWD5|ATPA_MANES ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q73HB2|ATPA_WOLPM ATP synthase subunit alpha OS=Wolbachia pipientis wMel GN=atpA PE=3 SV=1 49 517 0.0E+00
sp|Q814W0|ATPA_BACCR ATP synthase subunit alpha OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|P09219|ATPA_BACP3 ATP synthase subunit alpha OS=Bacillus sp. (strain PS3) GN=atpA PE=1 SV=1 50 552 0.0E+00
sp|A8FIB4|ATPA_BACP2 ATP synthase subunit alpha OS=Bacillus pumilus (strain SAFR-032) GN=atpA PE=3 SV=1 50 530 0.0E+00
sp|Q318U1|ATPA_PROM9 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9312) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A4QLR8|ATPA_NASOF ATP synthase subunit alpha, chloroplastic OS=Nasturtium officinale GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q8Y4C0|ATPA2_LISMO ATP synthase subunit alpha 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=atpA2 PE=3 SV=1 50 550 0.0E+00
sp|A4QK03|ATPA_ARAHI ATP synthase subunit alpha, chloroplastic OS=Arabis hirsuta GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B7HFK4|ATPA_BACC4 ATP synthase subunit alpha OS=Bacillus cereus (strain B4264) GN=atpA PE=3 SV=1 50 553 0.0E+00
sp|A0ALL5|ATPA2_LISW6 ATP synthase subunit alpha 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=atpA2 PE=3 SV=1 50 550 0.0E+00
sp|Q46J57|ATPA_PROMT ATP synthase subunit alpha OS=Prochlorococcus marinus (strain NATL2A) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q927W2|ATPA2_LISIN ATP synthase subunit alpha 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=atpA2 PE=3 SV=1 50 550 0.0E+00
sp|Q32RS8|ATPA_STAPU ATP synthase subunit alpha, chloroplastic OS=Staurastrum punctulatum GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q9BBS3|ATPA_LOTJA ATP synthase subunit alpha, chloroplastic OS=Lotus japonicus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q6YXK3|ATPA_PHYPA ATP synthase subunit alpha, chloroplastic OS=Physcomitrella patens subsp. patens GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|A4QK90|ATPA_BARVE ATP synthase subunit alpha, chloroplastic OS=Barbarea verna GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A4QL91|ATPA_LEPVR ATP synthase subunit alpha, chloroplastic OS=Lepidium virginicum GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A8G6V1|ATPA_PROM2 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9215) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A4QJR8|ATPA_OLIPU ATP synthase subunit alpha, chloroplastic OS=Olimarabidopsis pumila GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B1JFU3|ATPA_PSEPW ATP synthase subunit alpha OS=Pseudomonas putida (strain W619) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|A2BT25|ATPA_PROMS ATP synthase subunit alpha OS=Prochlorococcus marinus (strain AS9601) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q3M9W0|ATPA_ANAVT ATP synthase subunit alpha OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpA PE=3 SV=2 48 551 0.0E+00
sp|Q06H12|ATPA_DRIGR ATP synthase subunit alpha, chloroplastic OS=Drimys granadensis GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q4G397|ATPA_EMIHU ATP synthase subunit alpha, chloroplastic OS=Emiliania huxleyi GN=atpA PE=3 SV=1 48 543 0.0E+00
sp|P12405|ATPA_NOSS1 ATP synthase subunit alpha OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=atpA PE=3 SV=2 48 551 0.0E+00
sp|Q7YJY4|ATPA_CALFG ATP synthase subunit alpha, chloroplastic OS=Calycanthus floridus var. glaucus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A0T0P4|ATPA_THAPS ATP synthase subunit alpha, chloroplastic OS=Thalassiosira pseudonana GN=atpA PE=3 SV=1 48 542 0.0E+00
sp|A5GV72|ATPA_SYNR3 ATP synthase subunit alpha OS=Synechococcus sp. (strain RCC307) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|A4QL04|ATPA_DRANE ATP synthase subunit alpha, chloroplastic OS=Draba nemorosa GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A4QLH9|ATPA_LOBMA ATP synthase subunit alpha, chloroplastic OS=Lobularia maritima GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A4GGB2|ATPA_PHAVU ATP synthase subunit alpha, chloroplastic OS=Phaseolus vulgaris GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A4QKH7|ATPA_CAPBU ATP synthase subunit alpha, chloroplastic OS=Capsella bursa-pastoris GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B0KRB0|ATPA_PSEPG ATP synthase subunit alpha OS=Pseudomonas putida (strain GB-1) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|B9KES1|ATPA_CAMLR ATP synthase subunit alpha OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=atpA PE=3 SV=1 45 547 0.0E+00
sp|A1XFU0|ATPA_NUPAD ATP synthase subunit alpha, chloroplastic OS=Nuphar advena GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|P56757|ATPA_ARATH ATP synthase subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=atpA PE=1 SV=1 50 552 0.0E+00
sp|Q21DK6|ATPA_SACD2 ATP synthase subunit alpha OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=atpA PE=3 SV=1 47 547 0.0E+00
sp|A5GNC8|ATPA_SYNPW ATP synthase subunit alpha OS=Synechococcus sp. (strain WH7803) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A3PET9|ATPA_PROM0 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9301) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q0G9N4|ATPA_LIRTU ATP synthase subunit alpha, chloroplastic OS=Liriodendron tulipifera GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q8MA05|ATPA_CHAGL ATP synthase subunit alpha, chloroplastic OS=Chaetosphaeridium globosum GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|B3PIS9|ATPA_CELJU ATP synthase subunit alpha OS=Cellvibrio japonicus (strain Ueda107) GN=atpA PE=3 SV=1 47 543 0.0E+00
sp|Q2PMS8|ATPA_SOYBN ATP synthase subunit alpha, chloroplastic OS=Glycine max GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A9KK94|ATPA_CLOPH ATP synthase subunit alpha OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|A6MVW4|ATPA_RHDSA ATP synthase subunit alpha, chloroplastic OS=Rhodomonas salina GN=atpA PE=3 SV=1 48 526 0.0E+00
sp|A5WBA5|ATPA_PSEP1 ATP synthase subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|Q477Z3|ATPA_DECAR ATP synthase subunit alpha OS=Dechloromonas aromatica (strain RCB) GN=atpA PE=3 SV=1 47 552 0.0E+00
sp|Q00820|ATPA_ODOSI ATP synthase subunit alpha, chloroplastic OS=Odontella sinensis GN=atpA PE=3 SV=1 48 542 0.0E+00
sp|Q37380|ATPA_ACACA ATP synthase subunit alpha, mitochondrial OS=Acanthamoeba castellanii GN=ATP1 PE=3 SV=1 45 520 0.0E+00
sp|Q49L13|ATPA_EUCGG ATP synthase subunit alpha, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|A4Y189|ATPA_PSEMY ATP synthase subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|P26679|ATPA_ENTHA ATP synthase subunit alpha OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=atpA PE=3 SV=1 50 526 0.0E+00
sp|Q1IIG6|ATPA_KORVE ATP synthase subunit alpha OS=Koribacter versatilis (strain Ellin345) GN=atpA PE=3 SV=1 44 553 0.0E+00
sp|B7GMF5|ATPA_ANOFW ATP synthase subunit alpha OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=atpA PE=3 SV=1 38 552 0.0E+00
sp|Q88BX2|ATPA_PSEPK ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|C1FQP3|ATPA_CLOBJ ATP synthase subunit alpha OS=Clostridium botulinum (strain Kyoto / Type A2) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A5HY50|ATPA_CLOBH ATP synthase subunit alpha OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|C3KYJ1|ATPA_CLOB6 ATP synthase subunit alpha OS=Clostridium botulinum (strain 657 / Type Ba4) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A7FQH7|ATPA_CLOB1 ATP synthase subunit alpha OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q5P9M4|ATPA_ANAMM ATP synthase subunit alpha OS=Anaplasma marginale (strain St. Maries) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|B9KH09|ATPA_ANAMF ATP synthase subunit alpha OS=Anaplasma marginale (strain Florida) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|Q04ZU3|ATPA_LEPBL ATP synthase subunit alpha OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|Q04S16|ATPA_LEPBJ ATP synthase subunit alpha OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=atpA PE=3 SV=1 45 552 0.0E+00
sp|A2C4J5|ATPA_PROM1 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain NATL1A) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A6MMA7|ATPA_CHLSC ATP synthase subunit alpha, chloroplastic OS=Chloranthus spicatus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A7Y3A4|ATPA_IPOPU ATP synthase subunit alpha, chloroplastic OS=Ipomoea purpurea GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A2BYH6|ATPA_PROM5 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9515) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q0G9X7|ATPA_DAUCA ATP synthase subunit alpha, chloroplastic OS=Daucus carota GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q7VA63|ATPA_PROMA ATP synthase subunit alpha OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=atpA PE=3 SV=1 48 542 0.0E+00
sp|A7G9Q7|ATPA_CLOBL ATP synthase subunit alpha OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|B1IE32|ATPA_CLOBK ATP synthase subunit alpha OS=Clostridium botulinum (strain Okra / Type B1) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A1K1S0|ATPA_AZOSB ATP synthase subunit alpha OS=Azoarcus sp. (strain BH72) GN=atpA PE=3 SV=1 47 526 0.0E+00
sp|Q06RE6|ATPA_JASNU ATP synthase subunit alpha, chloroplastic OS=Jasminum nudiflorum GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q2L8Z1|ATPA_GOSHI ATP synthase subunit alpha, chloroplastic OS=Gossypium hirsutum GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q09X32|ATPA_MORIN ATP synthase subunit alpha, chloroplastic OS=Morus indica GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q1LHK8|ATPA_CUPMC ATP synthase subunit alpha OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=atpA PE=3 SV=1 47 550 0.0E+00
sp|Q09G61|ATPA_PLAOC ATP synthase subunit alpha, chloroplastic OS=Platanus occidentalis GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B2HQK4|ATPA_MYCMM ATP synthase subunit alpha OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=atpA PE=3 SV=1 42 553 0.0E+00
sp|P06283|ATPA_MARPO ATP synthase subunit alpha, chloroplastic OS=Marchantia polymorpha GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q0ZJ35|ATPA_VITVI ATP synthase subunit alpha, chloroplastic OS=Vitis vinifera GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q85AU2|ATPA_ANTFO ATP synthase subunit alpha, chloroplastic OS=Anthoceros formosae GN=atpA PE=2 SV=1 48 552 0.0E+00
sp|Q7V5S7|ATPA_PROMM ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9313) GN=atpA PE=3 SV=1 48 541 0.0E+00
sp|B1KSS6|ATPA_CLOBM ATP synthase subunit alpha OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|Q88UU1|ATPA_LACPL ATP synthase subunit alpha OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=atpA PE=3 SV=1 50 526 0.0E+00
sp|C5BKJ7|ATPA_TERTT ATP synthase subunit alpha OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|Q589B3|ATPA_SILLA ATP synthase subunit alpha, chloroplastic OS=Silene latifolia GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A4GYP3|ATPA_POPTR ATP synthase subunit alpha, chloroplastic OS=Populus trichocarpa GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q14FH2|ATPA_POPAL ATP synthase subunit alpha, chloroplastic OS=Populus alba GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q1Q897|ATPA_PSYCK ATP synthase subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=atpA PE=3 SV=1 47 547 0.0E+00
sp|A0PUK2|ATPA_MYCUA ATP synthase subunit alpha OS=Mycobacterium ulcerans (strain Agy99) GN=atpA PE=3 SV=1 42 553 0.0E+00
sp|Q4FQ35|ATPA_PSYA2 ATP synthase subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|Q3ZJ00|ATPA_PSEAK ATP synthase subunit alpha, chloroplastic OS=Pseudendoclonium akinetum GN=atpA PE=3 SV=1 45 542 0.0E+00
sp|B0JWV1|ATPA_MICAN ATP synthase subunit alpha OS=Microcystis aeruginosa (strain NIES-843) GN=atpA PE=3 SV=1 48 551 0.0E+00
sp|B0SLC6|ATPA_LEPBP ATP synthase subunit alpha OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=atpA PE=3 SV=1 45 553 0.0E+00
sp|B0SDA3|ATPA_LEPBA ATP synthase subunit alpha OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=atpA PE=3 SV=1 45 553 0.0E+00
sp|P35009|ATPA_GALSU ATP synthase subunit alpha, chloroplastic OS=Galdieria sulphuraria GN=atpA PE=3 SV=1 48 525 0.0E+00
sp|B9E8E8|ATPA_MACCJ ATP synthase subunit alpha OS=Macrococcus caseolyticus (strain JCSC5402) GN=atpA PE=3 SV=1 50 551 0.0E+00
sp|B1A920|ATPA_CARPA ATP synthase subunit alpha, chloroplastic OS=Carica papaya GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A6MM21|ATPA_BUXMI ATP synthase subunit alpha, chloroplastic OS=Buxus microphylla GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A2RMI4|ATPA_LACLM ATP synthase subunit alpha OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=atpA PE=3 SV=1 49 547 0.0E+00
sp|A3DIM7|ATPA_CLOTH ATP synthase subunit alpha OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q9TL16|ATPA_NEPOL ATP synthase subunit alpha, chloroplastic OS=Nephroselmis olivacea GN=atpA PE=3 SV=1 45 535 0.0E+00
sp|Q09FX6|ATPA_NANDO ATP synthase subunit alpha, chloroplastic OS=Nandina domestica GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|A8W3H5|ATPA_CUSOB ATP synthase subunit alpha, plastid OS=Cuscuta obtusiflora GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q831A3|ATPA_ENTFA ATP synthase subunit alpha OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|B2Y1W2|ATPA_WELMI ATP synthase subunit alpha, chloroplastic OS=Welwitschia mirabilis GN=atpA PE=3 SV=1 48 548 0.0E+00
sp|Q8F2J2|ATPA_LEPIN ATP synthase subunit alpha OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=atpA PE=3 SV=2 45 552 0.0E+00
sp|Q72SY1|ATPA_LEPIC ATP synthase subunit alpha OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=atpA PE=3 SV=2 45 552 0.0E+00
sp|A0T0F1|ATPA_PHATC ATP synthase subunit alpha, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=atpA PE=3 SV=1 48 542 0.0E+00
sp|A7M8Y9|ATPA_CUSGR ATP synthase subunit alpha, plastid OS=Cuscuta gronovii GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q32RL1|ATPA_ZYGCR ATP synthase subunit alpha, chloroplastic OS=Zygnema circumcarinatum GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|A6MMJ2|ATPA_DIOEL ATP synthase subunit alpha, chloroplastic OS=Dioscorea elephantipes GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|C1F3N8|ATPA_ACIC5 ATP synthase subunit alpha OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=atpA PE=3 SV=1 44 552 0.0E+00
sp|Q68S21|ATPA_PANGI ATP synthase subunit alpha, chloroplastic OS=Panax ginseng GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q09MJ3|ATPA_CITSI ATP synthase subunit alpha, chloroplastic OS=Citrus sinensis GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|A9BCD9|ATPA_PROM4 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9211) GN=atpA PE=3 SV=1 48 542 0.0E+00
sp|Q6MAK5|ATPA_PARUW ATP synthase subunit alpha OS=Protochlamydia amoebophila (strain UWE25) GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|B1Y3S9|ATPA_LEPCP ATP synthase subunit alpha OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|Q3AHK5|ATPA_SYNSC ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9605) GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|C3K1E8|ATPA_PSEFS ATP synthase subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|Q06FX6|ATPA_PELHO ATP synthase subunit alpha, chloroplastic OS=Pelargonium hortorum GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q332Y4|ATPA_LACSA ATP synthase subunit alpha, chloroplastic OS=Lactuca sativa GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q8RC17|ATPA_CALS4 ATP synthase subunit alpha OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=atpA PE=3 SV=1 48 541 0.0E+00
sp|P42005|ATPA_GEOSE ATP synthase subunit alpha OS=Geobacillus stearothermophilus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q5GSX1|ATPA_WOLTR ATP synthase subunit alpha OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|P30392|ATPA_EUGGR ATP synthase subunit alpha, chloroplastic OS=Euglena gracilis GN=atpA PE=3 SV=1 45 551 0.0E+00
sp|A8W3A9|ATPA_CUSEX ATP synthase subunit alpha, plastid OS=Cuscuta exaltata GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|A0A320|ATPA_COFAR ATP synthase subunit alpha, chloroplastic OS=Coffea arabica GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A6W3T0|ATPA2_MARMS ATP synthase subunit alpha 2 OS=Marinomonas sp. (strain MWYL1) GN=atpA2 PE=3 SV=1 47 547 0.0E+00
sp|Q3ZZT9|ATPA_DEHMC ATP synthase subunit alpha OS=Dehalococcoides mccartyi (strain CBDB1) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A5FRQ3|ATPA_DEHMB ATP synthase subunit alpha OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A4GAH1|ATPA_HERAR ATP synthase subunit alpha OS=Herminiimonas arsenicoxydans GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|Q3BAQ7|ATPA_PHAAO ATP synthase subunit alpha, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A7M951|ATPA_CUSRE ATP synthase subunit alpha, plastid OS=Cuscuta reflexa GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|P48080|ATPA_CYAPA ATP synthase subunit alpha, cyanelle OS=Cyanophora paradoxa GN=atpA PE=3 SV=1 48 553 0.0E+00
sp|A0ZZ20|ATPA_GOSBA ATP synthase subunit alpha, chloroplastic OS=Gossypium barbadense GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q85FN4|ATPA_ADICA ATP synthase subunit alpha, chloroplastic OS=Adiantum capillus-veneris GN=atpA PE=2 SV=2 48 552 0.0E+00
sp|Q70XV0|ATPA_AMBTC ATP synthase subunit alpha, chloroplastic OS=Amborella trichopoda GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q3V549|ATPA_ACOCL ATP synthase subunit alpha, chloroplastic OS=Acorus calamus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A9LYH0|ATPA_ACOAM ATP synthase subunit alpha, chloroplastic OS=Acorus americanus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A6MMS9|ATPA_ILLOL ATP synthase subunit alpha, chloroplastic OS=Illicium oligandrum GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|A6H5F1|ATPA_CYCTA ATP synthase subunit alpha, chloroplastic OS=Cycas taitungensis GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q2QDA3|ATPA_CUCSA ATP synthase subunit alpha, chloroplastic OS=Cucumis sativus GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|Q2S432|ATPA_SALRD ATP synthase subunit alpha OS=Salinibacter ruber (strain DSM 13855 / M31) GN=atpA PE=3 SV=1 48 543 0.0E+00
sp|Q2GER5|ATPA_NEOSM ATP synthase subunit alpha OS=Neorickettsia sennetsu (strain Miyayama) GN=atpA PE=3 SV=1 49 534 0.0E+00
sp|Q9KNH3|ATPA_VIBCH ATP synthase subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=atpA PE=3 SV=2 49 547 0.0E+00
sp|A5F457|ATPA_VIBC3 ATP synthase subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=atpA PE=3 SV=1 49 547 0.0E+00
sp|Q1QSC8|ATPA_CHRSD ATP synthase subunit alpha OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=atpA PE=3 SV=1 47 547 0.0E+00
sp|Q03EL2|ATPA_PEDPA ATP synthase subunit alpha OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=atpA PE=3 SV=1 50 547 0.0E+00
sp|Q1GXM8|ATPA_METFK ATP synthase subunit alpha OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=atpA PE=3 SV=1 47 527 0.0E+00
sp|P08215|ATPA_PEA ATP synthase subunit alpha, chloroplastic OS=Pisum sativum GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|Q19VA5|ATPA_CHLAT ATP synthase subunit alpha, chloroplastic OS=Chlorokybus atmophyticus GN=atpA PE=3 SV=2 45 551 0.0E+00
sp|A0R202|ATPA_MYCS2 ATP synthase subunit alpha OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=atpA PE=1 SV=1 42 551 0.0E+00
sp|A1VIV0|ATPA1_POLNA ATP synthase subunit alpha 1 OS=Polaromonas naphthalenivorans (strain CJ2) GN=atpA1 PE=3 SV=1 47 551 0.0E+00
sp|Q5P4E4|ATPA_AROAE ATP synthase subunit alpha OS=Aromatoleum aromaticum (strain EbN1) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|B1MLW0|ATPA_MYCA9 ATP synthase subunit alpha OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|Q3Z8Z4|ATPA_DEHM1 ATP synthase subunit alpha OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=atpA PE=3 SV=1 50 541 0.0E+00
sp|P12985|ATPA_VIBAL ATP synthase subunit alpha OS=Vibrio alginolyticus GN=atpA PE=1 SV=1 49 547 0.0E+00
sp|Q1I2I5|ATPA_PSEE4 ATP synthase subunit alpha OS=Pseudomonas entomophila (strain L48) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|Q9HT18|ATPA_PSEAE ATP synthase subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|Q02DF2|ATPA_PSEAB ATP synthase subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|B7V793|ATPA_PSEA8 ATP synthase subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|A6VF34|ATPA_PSEA7 ATP synthase subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|A6YG64|ATPA_LEPTE ATP synthase subunit alpha, chloroplastic OS=Leptosira terrestris GN=atpA PE=3 SV=1 50 552 0.0E+00
sp|B4EEY7|ATPA_BURCJ ATP synthase subunit alpha OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=atpA PE=3 SV=1 47 550 0.0E+00
sp|Q9MTL7|ATPA_OENEH ATP synthase subunit alpha, chloroplastic OS=Oenothera elata subsp. hookeri GN=atpA PE=3 SV=2 50 542 0.0E+00
sp|Q73X57|ATPA_MYCPA ATP synthase subunit alpha OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=atpA PE=3 SV=1 42 551 0.0E+00
sp|A0QCX6|ATPA_MYCA1 ATP synthase subunit alpha OS=Mycobacterium avium (strain 104) GN=atpA PE=3 SV=1 42 551 0.0E+00
sp|Q49Z52|ATPA_STAS1 ATP synthase subunit alpha OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=atpA PE=3 SV=1 50 550 0.0E+00
sp|B0Z550|ATPA_OENGL ATP synthase subunit alpha, chloroplastic OS=Oenothera glazioviana GN=atpA PE=3 SV=1 50 542 0.0E+00
sp|A6T472|ATPA_JANMA ATP synthase subunit alpha OS=Janthinobacterium sp. (strain Marseille) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|A4VS64|ATPA_PSEU5 ATP synthase subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|Q4K3A7|ATPA_PSEF5 ATP synthase subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=atpA PE=3 SV=1 47 541 0.0E+00
sp|A2T317|ATPA_ANGEV ATP synthase subunit alpha, chloroplastic OS=Angiopteris evecta GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|Q87KA6|ATPA_VIBPA ATP synthase subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=atpA PE=3 SV=1 49 547 0.0E+00
sp|Q8WI30|ATPA_PSINU ATP synthase subunit alpha, chloroplastic OS=Psilotum nudum GN=atpA PE=3 SV=1 48 552 0.0E+00
sp|A9BPU5|ATPA_DELAS ATP synthase subunit alpha OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=atpA PE=3 SV=1 47 551 0.0E+00
sp|B0Z5D4|ATPA_OENPA ATP synthase subunit alpha, chloroplastic OS=Oenothera parviflora GN=atpA PE=3 SV=1 50 542 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0046034 ATP metabolic process Yes
GO:0015986 proton motive force-driven ATP synthesis Yes
GO:1902600 proton transmembrane transport Yes
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0017076 purine nucleotide binding No
GO:0006810 transport No
GO:0044281 small molecule metabolic process No
GO:0098662 inorganic cation transmembrane transport No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0030554 adenyl nucleotide binding No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043167 ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0043168 anion binding No
GO:0006811 ion transport No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0006812 cation transport No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006754 ATP biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0008152 metabolic process No
GO:0098660 inorganic ion transmembrane transport No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0051234 establishment of localization No
GO:0098655 cation transmembrane transport No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0051179 localization No
GO:0071704 organic substance metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0036094 small molecule binding No
GO:0055085 transmembrane transport No
GO:0044238 primary metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0034220 ion transmembrane transport No
GO:0006753 nucleoside phosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4918
MFRNAIRQSTRAVGAVSAAGRVAAVRNVAPAAMTMQSRCYAADAKASPTEVSSILEQRIRGVQEESNLAETGRVL
SVGDGIARVHGLTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGNDRLVAEGQSVKRTGEIVDVPVGPELLGRV
IDALGNPIDGKGPINAKEKRRAQLKAPGILPRKSVNQPVQTGFKSIDAMVPIGRGQRELIIGDRQTGKTAIAIDA
MLNQKRWNDGTQEDKKLYCVYVAVGQKRSTVAQLVRTLEEADAMKYSIIVAATASEAAPLQYLAPFTGASVGEWF
RDNGKHALLVLDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDKHGGGSLTCTPIVETQGG
DVSAYIPTNVISITDGQIFLEQELFFKGVRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFAQFG
SDLDASTKQTLARGERLTELLKQKQYSPMAVNEMVPLIYAGVNGYLDAIPVDKVLQWESDYLAHLKSNESELLAT
IDKEGVISDATDAKLKEITPAFIKSFLS*
Coding >OphauB2|4918
ATGTTCCGGAACGCCATCCGACAGTCCACCCGTGCCGTGGGTGCCGTTTCGGCCGCTGGTCGGGTCGCCGCGGTT
CGAAATGTCGCACCCGCCGCCATGACGATGCAGTCGCGATGCTATGCCGCCGATGCCAAGGCCTCGCCCACTGAA
GTTTCGTCGATTCTCGAGCAGCGCATCCGTGGTGTCCAGGAGGAGTCCAACCTTGCTGAAACTGGCCGCGTGCTG
TCCGTCGGTGACGGTATTGCTCGTGTACACGGCTTGACCAATGTCCAGGCCGAGGAGCTTGTTGAGTTCGCATCT
GGCGTCAAGGGCATGTGCATGAACCTCGAGGCTGGCCAAGTTGGTGTTGTGCTCTTTGGTAATGATCGCTTGGTC
GCCGAGGGCCAATCTGTCAAGCGTACCGGCGAAATTGTGGACGTTCCCGTCGGTCCCGAGCTGCTTGGGCGTGTC
ATTGATGCCCTGGGCAACCCAATTGACGGCAAGGGACCCATCAACGCCAAGGAGAAGCGTCGTGCCCAACTCAAG
GCCCCTGGCATTCTGCCTCGCAAATCTGTCAACCAGCCCGTACAGACTGGATTCAAGTCGATTGACGCCATGGTT
CCCATTGGTCGAGGTCAGCGTGAGCTCATCATTGGTGACCGTCAAACGGGAAAGACGGCCATTGCCATCGACGCT
ATGCTCAACCAGAAACGATGGAACGATGGCACTCAAGAAGACAAGAAGCTCTACTGCGTCTACGTCGCCGTCGGC
CAGAAGCGCTCTACGGTGGCACAGCTAGTGCGTACCTTGGAGGAAGCAGATGCCATGAAGTACTCCATCATTGTC
GCTGCTACTGCATCCGAGGCGGCTCCATTGCAGTATCTTGCACCATTCACCGGCGCCTCTGTGGGCGAGTGGTTC
AGGGACAATGGAAAGCATGCTCTGCTTGTTTTGGATGACTTGAGCAAGCAAGCCGTCGCTTACCGTCAACTTTCA
CTTTTGCTTCGCCGTCCTCCAGGCCGTGAGGCGTACCCCGGCGATGTCTTCTATCTTCACTCACGACTTTTGGAG
CGTGCAGCCAAGCTCAACGATAAACATGGAGGAGGCAGCCTTACATGTACCCCAATAGTGGAGACTCAGGGAGGA
GATGTGTCTGCTTATATCCCGACCAATGTCATTTCGATTACCGACGGCCAAATCTTCCTCGAACAGGAGCTCTTC
TTCAAGGGTGTTCGTCCGGCCATCAATGTCGGCCTTTCAGTCTCTCGCGTCGGTTCTGCTGCTCAGCTCAAGGCC
ATGAAACAAGTCGCTGGTTCTCTCAAGCTCTTCTTGGCCCAGTACCGTGAAGTGGCTGCCTTTGCTCAGTTTGGC
TCTGATCTCGATGCCTCTACCAAGCAGACTCTGGCCCGTGGCGAGCGTTTGACGGAACTTCTCAAGCAAAAACAA
TACTCACCCATGGCTGTCAATGAAATGGTTCCCCTCATTTACGCTGGTGTCAATGGCTATTTGGACGCGATTCCC
GTCGACAAGGTGTTGCAGTGGGAGTCGGACTACTTGGCGCACCTCAAGTCAAACGAGTCGGAGCTATTGGCCACG
ATTGACAAGGAGGGCGTAATTAGCGACGCAACAGATGCCAAGCTCAAGGAGATTACACCTGCCTTCATCAAGAGC
TTCCTCAGCTAA
Transcript >OphauB2|4918
ATGTTCCGGAACGCCATCCGACAGTCCACCCGTGCCGTGGGTGCCGTTTCGGCCGCTGGTCGGGTCGCCGCGGTT
CGAAATGTCGCACCCGCCGCCATGACGATGCAGTCGCGATGCTATGCCGCCGATGCCAAGGCCTCGCCCACTGAA
GTTTCGTCGATTCTCGAGCAGCGCATCCGTGGTGTCCAGGAGGAGTCCAACCTTGCTGAAACTGGCCGCGTGCTG
TCCGTCGGTGACGGTATTGCTCGTGTACACGGCTTGACCAATGTCCAGGCCGAGGAGCTTGTTGAGTTCGCATCT
GGCGTCAAGGGCATGTGCATGAACCTCGAGGCTGGCCAAGTTGGTGTTGTGCTCTTTGGTAATGATCGCTTGGTC
GCCGAGGGCCAATCTGTCAAGCGTACCGGCGAAATTGTGGACGTTCCCGTCGGTCCCGAGCTGCTTGGGCGTGTC
ATTGATGCCCTGGGCAACCCAATTGACGGCAAGGGACCCATCAACGCCAAGGAGAAGCGTCGTGCCCAACTCAAG
GCCCCTGGCATTCTGCCTCGCAAATCTGTCAACCAGCCCGTACAGACTGGATTCAAGTCGATTGACGCCATGGTT
CCCATTGGTCGAGGTCAGCGTGAGCTCATCATTGGTGACCGTCAAACGGGAAAGACGGCCATTGCCATCGACGCT
ATGCTCAACCAGAAACGATGGAACGATGGCACTCAAGAAGACAAGAAGCTCTACTGCGTCTACGTCGCCGTCGGC
CAGAAGCGCTCTACGGTGGCACAGCTAGTGCGTACCTTGGAGGAAGCAGATGCCATGAAGTACTCCATCATTGTC
GCTGCTACTGCATCCGAGGCGGCTCCATTGCAGTATCTTGCACCATTCACCGGCGCCTCTGTGGGCGAGTGGTTC
AGGGACAATGGAAAGCATGCTCTGCTTGTTTTGGATGACTTGAGCAAGCAAGCCGTCGCTTACCGTCAACTTTCA
CTTTTGCTTCGCCGTCCTCCAGGCCGTGAGGCGTACCCCGGCGATGTCTTCTATCTTCACTCACGACTTTTGGAG
CGTGCAGCCAAGCTCAACGATAAACATGGAGGAGGCAGCCTTACATGTACCCCAATAGTGGAGACTCAGGGAGGA
GATGTGTCTGCTTATATCCCGACCAATGTCATTTCGATTACCGACGGCCAAATCTTCCTCGAACAGGAGCTCTTC
TTCAAGGGTGTTCGTCCGGCCATCAATGTCGGCCTTTCAGTCTCTCGCGTCGGTTCTGCTGCTCAGCTCAAGGCC
ATGAAACAAGTCGCTGGTTCTCTCAAGCTCTTCTTGGCCCAGTACCGTGAAGTGGCTGCCTTTGCTCAGTTTGGC
TCTGATCTCGATGCCTCTACCAAGCAGACTCTGGCCCGTGGCGAGCGTTTGACGGAACTTCTCAAGCAAAAACAA
TACTCACCCATGGCTGTCAATGAAATGGTTCCCCTCATTTACGCTGGTGTCAATGGCTATTTGGACGCGATTCCC
GTCGACAAGGTGTTGCAGTGGGAGTCGGACTACTTGGCGCACCTCAAGTCAAACGAGTCGGAGCTATTGGCCACG
ATTGACAAGGAGGGCGTAATTAGCGACGCAACAGATGCCAAGCTCAAGGAGATTACACCTGCCTTCATCAAGAGC
TTCCTCAGCTAA
Gene >OphauB2|4918
ATGTTCCGGAACGCCATCCGACAGTCCACCCGTGCCGTGGGTGCCGTTTCGGCCGCTGGTCGGGTCGCCGCGGTG
AGTCTCTTCTCAACGCTTACGGCATCGACCATTTGAGCTATCCCGCCCCGTCCGAGAGCATCGAGAGACGAGGAC
CAGAGCTCGATTGAGCTGCCCCAGGCCCTGGTGCTGCTTTTTGGGCTTCTGTGTTCTGTTGCCGTAGCTGCGGCG
CTGCTGGATCGTAAGCGCGGGCTTGTTCGGCTGACAGCTCTCTGCTGCTTCAACAGGTTCGAAATGTCGCACCCG
CCGCCATGACGATGCAGTCGCGATGCTATGCCGCCGATGCCAAGGCCTCGCCCACTGAAGTTTCGTCGATTCTCG
AGCAGCGCATCCGTGGTGTCCAGGAGGAGTCCAACCTTGCTGAAACTGGCCGCGTGCTGTCCGTCGGGTATGTGG
AGATGAAGCACCCACGACCCCACCCCCAGTCGAATCTCCGCGATCCAGAACCTTTGGCACGATGCACAGCAGCAA
CCTCTGGGGCCACCTCGCGCAACGCAACACGCTAACGTTGTAATAGTGACGGTATTGCTCGTGTACACGGCTTGA
CCAATGTCCAGGCCGAGGAGCTTGTTGAGTATGTGGGTCCCCTGCTACTTGATACTAGGATGCTAACGCTGGCAT
AGGTTCGCATCTGGCGTCAAGGGCATGTGCATGAACCTCGAGGCTGGCCAAGTTGGTGTTGTGCTCTTTGGTAAT
GATCGCTTGGTCGCCGAGGGCCAATCTGTCAAGCGTACCGGCGAAATTGTATGTCGTCAATTAACTACGCAACGG
GATATTGCTGACCAGACCTGCAGGTGGACGTTCCCGTCGGTCCCGAGCTGCTTGGGCGTGTCATTGATGCCCTGG
GCAACCCAATTGACGGCAAGGGACCCATCAACGCCAAGGAGAAGCGTCGTGCCCAACTCAAGGCCCCTGGCATTC
TGCCTCGCAAATCTGTCAACCAGCCCGTACAGACTGGATTCAAGTCGATTGACGCCATGGTTCCCATTGGTCGAG
GTCAGCGTGAGCTCATCATTGGTGACCGTCAAACGGGAAAGACGGCCATTGCCATCGACGCTATGCTCAACCAGA
AACGATGGAACGATGGCACTCAAGAAGACAAGAAGCTCTACTGCGTCTACGTCGCCGTCGGCCAGAAGCGCTCTA
CGGTGGCACAGCTAGTGCGTACCTTGGAGGAAGCAGATGCCATGAAGTACTCCATCATTGTCGCTGCTACTGCAT
CCGAGGCGGCTCCATTGCAGTATCTTGCACCATTCACCGGTTAGTGGTCCCCTCTTGCTTTTATTAAACAATCAC
GTGCCGCTTGAGGTCACTGGTTTACGTCAGCAAGAAATTGTGTACAAGACACCAGACTGCCTCCCGGGTAGCATG
CGGTCGCGAGGCACTTGATGAATAACACGATGAATTCTTGCTAACCTCTGCAACACCAGGCGCCTCTGTGGGCGA
GTGGTTCAGGGACAATGGAAAGCATGCTCTGCTTGTTTTGGATGACTTGAGCAAGCAAGCCGTCGCTTACCGTCA
ACTTTCACTTTTGCTTCGCCGTCCTCCAGGCCGTGAGGCGTACCCCGGCGATGTCTTCTATCTTCACTCACGACT
TTTGGAGCGTGCAGCCAAGCTCAACGATAAACATGGAGGAGGCAGCCTTACATGTACCCCAATAGTGGAGACTCA
GGGAGGAGATGTGTCTGCTTATATCCCGACCAATGTCATTTCGATTACCGACGGCCAAATCTTCCTCGAACAGGA
GCTCTTCTTCAAGGGTGTTCGTCCGGCCATCAATGTCGGCCTTTCAGTCTCTCGCGTCGGTTCTGCTGCTCAGCT
CAAGGCCATGAAACAAGTCGCTGGTTCTCTCAAGCTCTTCTTGGCCCAGTACCGTGAAGTGGCTGCCTTTGCTCA
GTTTGGCTCTGATCTCGATGCCTCTACCAAGCAGACTCTGGCCCGTGGCGAGCGTGTAAGTTGAATGCTAGGTTT
GAAGGTGCTGAACCGAGATTGGCTAACTGGTCGACAGTTGACGGAACTTCTCAAGCAAAAACAATACTCACCCAT
GGCTGTCAATGAAATGGTTCCCCTCATTTACGCTGGTGTCAATGGCTATTTGGACGCGATTCCCGTCGACAAGGT
GTTGCAGTGGGAGTCGGACTACTTGGCGCACCTCAAGTCAAACGAGTCGGAGCTATTGGCCACGATTGACAAGGA
GGGCGTAATTAGCGACGCAACAGATGCCAAGCTCAAGGAGATTACACCTGCCTTCATCAAGAGCTTCCTCAGCTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail