Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4916
Gene name
LocationContig_35:60568..61209
Strand+
Gene length (bp)641
Transcript length (bp)522
Coding sequence length (bp)522
Protein length (aa) 174

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus 3.4E-22 65 146
PF00281 Ribosomal_L5 Ribosomal protein L5 1.4E-20 8 61

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVN0|RL11_NEUCR 60S ribosomal protein L11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-11 PE=3 SV=2 4 173 8.0E-113
sp|P0C0W9|RL11A_YEAST 60S ribosomal protein L11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11A PE=1 SV=2 3 172 9.0E-100
sp|Q3E757|RL11B_YEAST 60S ribosomal protein L11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11B PE=1 SV=3 3 172 1.0E-99
sp|Q758S7|RL11_ASHGO 60S ribosomal protein L11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL11 PE=3 SV=1 3 172 2.0E-99
sp|P0CT78|RL11B_SCHPO 60S ribosomal protein L11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1102 PE=2 SV=1 3 172 7.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVN0|RL11_NEUCR 60S ribosomal protein L11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-11 PE=3 SV=2 4 173 8.0E-113
sp|P0C0W9|RL11A_YEAST 60S ribosomal protein L11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11A PE=1 SV=2 3 172 9.0E-100
sp|Q3E757|RL11B_YEAST 60S ribosomal protein L11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11B PE=1 SV=3 3 172 1.0E-99
sp|Q758S7|RL11_ASHGO 60S ribosomal protein L11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL11 PE=3 SV=1 3 172 2.0E-99
sp|P0CT78|RL11B_SCHPO 60S ribosomal protein L11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1102 PE=2 SV=1 3 172 7.0E-98
sp|P0CT77|RL11A_SCHPO 60S ribosomal protein L11-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1101 PE=2 SV=1 3 172 7.0E-98
sp|Q6FTK4|RL11_CANGA 60S ribosomal protein L11 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL11 PE=3 SV=1 3 172 4.0E-97
sp|Q94300|RL11_CAEEL 60S ribosomal protein L11 OS=Caenorhabditis elegans GN=rpl-11.1 PE=3 SV=1 4 172 3.0E-94
sp|P42795|RL111_ARATH 60S ribosomal protein L11-1 OS=Arabidopsis thaliana GN=RPL11A PE=2 SV=2 1 172 8.0E-92
sp|P46287|RL11_MEDSA 60S ribosomal protein L11 OS=Medicago sativa GN=RPL11 PE=2 SV=1 1 172 1.0E-91
sp|P42794|RL112_ARATH 60S ribosomal protein L11-2 OS=Arabidopsis thaliana GN=RPL11B PE=2 SV=2 1 172 5.0E-91
sp|Q0DK10|RL11_ORYSJ 60S ribosomal protein L11 OS=Oryza sativa subsp. japonica GN=RPL11 PE=2 SV=1 1 172 4.0E-90
sp|A2YDY2|RL11_ORYSI 60S ribosomal protein L11 OS=Oryza sativa subsp. indica GN=RPL11 PE=2 SV=2 1 172 4.0E-90
sp|Q90YV7|RL11_ICTPU 60S ribosomal protein L11 OS=Ictalurus punctatus GN=rpl11 PE=2 SV=3 3 172 4.0E-90
sp|Q5RC11|RL11_PONAB 60S ribosomal protein L11 OS=Pongo abelii GN=RPL11 PE=2 SV=3 1 172 4.0E-90
sp|P62914|RL11_RAT 60S ribosomal protein L11 OS=Rattus norvegicus GN=Rpl11 PE=1 SV=2 1 172 2.0E-89
sp|Q9CXW4|RL11_MOUSE 60S ribosomal protein L11 OS=Mus musculus GN=Rpl11 PE=1 SV=4 1 172 2.0E-89
sp|P62913|RL11_HUMAN 60S ribosomal protein L11 OS=Homo sapiens GN=RPL11 PE=1 SV=2 1 172 2.0E-89
sp|Q6QMZ8|RL11_CHILA 60S ribosomal protein L11 OS=Chinchilla lanigera GN=RPL11 PE=2 SV=3 1 172 2.0E-89
sp|Q3T087|RL11_BOVIN 60S ribosomal protein L11 OS=Bos taurus GN=RPL11 PE=2 SV=3 1 172 2.0E-89
sp|Q29205|RL11_PIG 60S ribosomal protein L11 OS=Sus scrofa GN=RPL11 PE=1 SV=3 1 172 8.0E-89
sp|P46222|RL11_DROME 60S ribosomal protein L11 OS=Drosophila melanogaster GN=RpL11 PE=1 SV=2 4 172 1.0E-88
sp|P16168|RL11_DICDI 60S ribosomal protein L11 OS=Dictyostelium discoideum GN=rpl11 PE=1 SV=2 5 172 4.0E-85
sp|P42922|RL11_LEICH 60S ribosomal protein L11 OS=Leishmania chagasi GN=RPL11 PE=2 SV=1 1 172 1.0E-83
sp|P48157|RL11_LEIMA 60S ribosomal protein L11 OS=Leishmania major GN=RPL11 PE=3 SV=1 1 172 2.0E-83
sp|P24119|RL11_TETTH 60S ribosomal protein L11 OS=Tetrahymena thermophila GN=RPL11 PE=1 SV=1 3 172 9.0E-75
sp|Q962U2|RL11_SPOFR 60S ribosomal protein L11 OS=Spodoptera frugiperda GN=RpL11 PE=2 SV=1 6 172 1.0E-74
sp|P50881|RL11_CHLRE 60S ribosomal protein L11 OS=Chlamydomonas reinhardtii GN=RPL11 PE=2 SV=1 10 172 5.0E-74
sp|Q8SSG9|RL11_ENCCU 60S ribosomal protein L11 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL11 PE=1 SV=2 3 172 1.0E-70
sp|Q94793|RL11_TOXCA 60S ribosomal protein L11 (Fragment) OS=Toxocara canis GN=RPL11 PE=2 SV=1 5 116 3.0E-63
sp|Q9UX93|RL5_SULSO 50S ribosomal protein L5 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl5 PE=3 SV=1 6 169 8.0E-50
sp|Q5JJG1|RL5_THEKO 50S ribosomal protein L5 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl5 PE=3 SV=1 8 161 1.0E-47
sp|P54040|RL5_METJA 50S ribosomal protein L5 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl5 PE=3 SV=1 8 168 9.0E-46
sp|O59431|RL5_PYRHO 50S ribosomal protein L5 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl5 PE=3 SV=1 8 168 4.0E-44
sp|Q9YF87|RL5_AERPE 50S ribosomal protein L5 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl5 PE=3 SV=2 1 168 2.0E-43
sp|Q8U012|RL5_PYRFU 50S ribosomal protein L5 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl5 PE=1 SV=1 8 168 5.0E-43
sp|A6UQ57|RL5_METVS 50S ribosomal protein L5 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl5 PE=3 SV=1 9 168 7.0E-43
sp|P14029|RL5_METVA 50S ribosomal protein L5 OS=Methanococcus vannielii GN=rpl5 PE=3 SV=1 9 168 7.0E-43
sp|Q9V1U9|RL5_PYRAB 50S ribosomal protein L5 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl5 PE=3 SV=1 8 168 7.0E-43
sp|Q975J3|RL5_SULTO 50S ribosomal protein L5 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl5 PE=3 SV=2 1 169 2.0E-42
sp|Q12ZT8|RL5_METBU 50S ribosomal protein L5 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl5 PE=3 SV=1 7 168 3.0E-42
sp|Q6LXE0|RL5_METMP 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl5 PE=3 SV=1 9 169 4.0E-42
sp|P41202|RL5_SULAC 50S ribosomal protein L5 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl5 PE=3 SV=1 1 169 8.0E-42
sp|A9A9Q1|RL5_METM6 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl5 PE=3 SV=1 9 169 2.0E-41
sp|A6VGZ8|RL5_METM7 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl5 PE=3 SV=1 9 169 5.0E-41
sp|A5UL75|RL5_METS3 50S ribosomal protein L5 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl5 PE=3 SV=1 8 169 5.0E-41
sp|A4FWA8|RL5_METM5 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl5 PE=3 SV=1 9 169 7.0E-41
sp|A8MB19|RL5_CALMQ 50S ribosomal protein L5 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl5 PE=3 SV=1 8 166 1.0E-40
sp|Q97BW3|RL5_THEVO 50S ribosomal protein L5 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl5 PE=3 SV=1 8 168 1.0E-40
sp|Q74N79|RL5_NANEQ 50S ribosomal protein L5 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl5 PE=3 SV=1 7 168 2.0E-40
sp|O26124|RL5_METTH 50S ribosomal protein L5 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl5 PE=3 SV=1 8 168 2.0E-40
sp|A9A5I2|RL5_NITMS 50S ribosomal protein L5 OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl5 PE=3 SV=1 3 168 4.0E-40
sp|O28367|RL5_ARCFU 50S ribosomal protein L5 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl5 PE=3 SV=1 8 166 2.0E-38
sp|Q6L1B4|RL5_PICTO 50S ribosomal protein L5 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl5 PE=3 SV=1 4 169 2.0E-38
sp|A0RVY6|RL5_CENSY 50S ribosomal protein L5 OS=Cenarchaeum symbiosum (strain A) GN=rpl5 PE=3 SV=1 10 168 3.0E-38
sp|Q8PV37|RL5_METMA 50S ribosomal protein L5 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl5 PE=3 SV=1 7 168 6.0E-38
sp|Q2NFX0|RL5_METST 50S ribosomal protein L5 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl5 PE=3 SV=1 8 169 6.0E-38
sp|Q56231|RL5_THEAC 50S ribosomal protein L5 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl5 PE=3 SV=1 8 168 2.0E-37
sp|A7I5Q2|RL5_METB6 50S ribosomal protein L5 OS=Methanoregula boonei (strain 6A8) GN=rpl5 PE=3 SV=1 10 173 3.0E-37
sp|Q8TRT4|RL5_METAC 50S ribosomal protein L5 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl5 PE=3 SV=1 10 168 4.0E-37
sp|Q8TW17|RL5_METKA 50S ribosomal protein L5 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl5 PE=3 SV=1 7 169 5.0E-37
sp|B9LSR4|RL5_HALLT 50S ribosomal protein L5 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl5 PE=3 SV=1 3 169 1.0E-36
sp|P50559|RL5_HALVD 50S ribosomal protein L5 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rpl5 PE=1 SV=2 3 169 1.0E-36
sp|Q46GA8|RL5_METBF 50S ribosomal protein L5 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl5 PE=3 SV=1 7 168 4.0E-36
sp|Q3IMX5|RL5_NATPD 50S ribosomal protein L5 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl5 PE=3 SV=1 10 169 4.0E-36
sp|Q18GG2|RL5_HALWD 50S ribosomal protein L5 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl5 PE=3 SV=1 10 168 6.0E-36
sp|Q2FT38|RL5_METHJ 50S ribosomal protein L5 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl5 PE=3 SV=1 8 169 6.0E-36
sp|P50557|RL5_HALMT 50S ribosomal protein L5 OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=rpl5 PE=1 SV=2 3 169 9.0E-36
sp|A6UWV1|RL5_META3 50S ribosomal protein L5 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl5 PE=3 SV=1 9 163 9.0E-36
sp|P50558|RL5_HALSA 50S ribosomal protein L5 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl5 PE=1 SV=3 10 169 1.0E-35
sp|B0R669|RL5_HALS3 50S ribosomal protein L5 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl5 PE=3 SV=1 10 169 1.0E-35
sp|Q8ZSU7|RL5_PYRAE 50S ribosomal protein L5 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl5 PE=3 SV=1 8 166 1.0E-35
sp|A2SPL5|RL5_METLZ 50S ribosomal protein L5 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl5 PE=3 SV=1 10 168 8.0E-35
sp|P14124|RL5_HALMA 50S ribosomal protein L5 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl5 PE=1 SV=4 10 169 2.0E-34
sp|A3CT10|RL5_METMJ 50S ribosomal protein L5 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl5 PE=3 SV=1 10 168 2.0E-32
sp|A7IPQ8|RL5_XANP2 50S ribosomal protein L5 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplE PE=3 SV=1 8 133 5.0E-18
sp|A8IAQ3|RL5_AZOC5 50S ribosomal protein L5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplE PE=3 SV=1 8 133 1.0E-17
sp|Q8UE30|RL5_AGRFC 50S ribosomal protein L5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplE PE=3 SV=1 8 133 3.0E-16
sp|Q2YRA7|RL5_BRUA2 50S ribosomal protein L5 OS=Brucella abortus (strain 2308) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|Q8G085|RL5_BRUSU 50S ribosomal protein L5 OS=Brucella suis biovar 1 (strain 1330) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|B0CH20|RL5_BRUSI 50S ribosomal protein L5 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|A5VQZ4|RL5_BRUO2 50S ribosomal protein L5 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|Q8YHM8|RL5_BRUME 50S ribosomal protein L5 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|C0RJI9|RL5_BRUMB 50S ribosomal protein L5 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|A9M5N8|RL5_BRUC2 50S ribosomal protein L5 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|Q57CS0|RL5_BRUAB 50S ribosomal protein L5 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|B2S667|RL5_BRUA1 50S ribosomal protein L5 OS=Brucella abortus (strain S19) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|A7HWS3|RL5_PARL1 50S ribosomal protein L5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplE PE=3 SV=1 8 133 2.0E-15
sp|A6X0D0|RL5_OCHA4 50S ribosomal protein L5 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplE PE=3 SV=1 5 133 5.0E-15
sp|B9JVP9|RL5_AGRVS 50S ribosomal protein L5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplE PE=3 SV=1 8 141 7.0E-15
sp|Q98N45|RL5_RHILO 50S ribosomal protein L5 OS=Rhizobium loti (strain MAFF303099) GN=rplE PE=3 SV=1 7 133 1.0E-14
sp|Q134U1|RL5_RHOPS 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|Q11HR4|RL5_CHESB 50S ribosomal protein L5 OS=Chelativorans sp. (strain BNC1) GN=rplE PE=3 SV=1 5 133 2.0E-14
sp|Q9A8U1|RL5_CAUCR 50S ribosomal protein L5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplE PE=3 SV=1 7 133 2.0E-14
sp|B8H4E6|RL5_CAUCN 50S ribosomal protein L5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplE PE=3 SV=1 7 133 2.0E-14
sp|B3PWT3|RL5_RHIE6 50S ribosomal protein L5 OS=Rhizobium etli (strain CIAT 652) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|B9JDU0|RL5_AGRRK 50S ribosomal protein L5 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|Q2K9K4|RL5_RHIEC 50S ribosomal protein L5 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|B0T2D4|RL5_CAUSK 50S ribosomal protein L5 OS=Caulobacter sp. (strain K31) GN=rplE PE=3 SV=1 7 133 2.0E-14
sp|Q6FZD4|RL5_BARQU 50S ribosomal protein L5 OS=Bartonella quintana (strain Toulouse) GN=rplE PE=3 SV=1 4 133 3.0E-14
sp|A9IW11|RL5_BART1 50S ribosomal protein L5 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplE PE=3 SV=1 4 133 3.0E-14
sp|C4K7A6|RL5_HAMD5 50S ribosomal protein L5 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplE PE=3 SV=1 10 133 4.0E-14
sp|Q07KN0|RL5_RHOP5 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplE PE=3 SV=1 8 133 4.0E-14
sp|B5ZYU7|RL5_RHILW 50S ribosomal protein L5 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplE PE=3 SV=1 8 133 5.0E-14
sp|Q211G0|RL5_RHOPB 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplE PE=3 SV=1 8 133 6.0E-14
sp|B3QBW8|RL5_RHOPT 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|Q6N4U5|RL5_RHOPA 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplE PE=1 SV=1 8 133 1.0E-13
sp|Q6G2X7|RL5_BARHE 50S ribosomal protein L5 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplE PE=3 SV=1 4 133 1.0E-13
sp|B6JEX7|RL5_OLICO 50S ribosomal protein L5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplE PE=3 SV=1 7 133 1.0E-13
sp|B4R8M9|RL5_PHEZH 50S ribosomal protein L5 OS=Phenylobacterium zucineum (strain HLK1) GN=rplE PE=3 SV=1 7 133 1.0E-13
sp|Q5GWU7|RL5_XANOR 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|B2SQS2|RL5_XANOP 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|Q2NZZ7|RL5_XANOM 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|A6U871|RL5_SINMW 50S ribosomal protein L5 OS=Sinorhizobium medicae (strain WSM419) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|Q8PC39|RL5_XANCP 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|B0RU70|RL5_XANCB 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|Q4URF1|RL5_XANC8 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|Q6MSN8|RL5_MYCMS 50S ribosomal protein L5 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplE PE=3 SV=1 10 133 3.0E-13
sp|Q3BWX1|RL5_XANC5 50S ribosomal protein L5 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q1MIC9|RL5_RHIL3 50S ribosomal protein L5 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q8PNR4|RL5_XANAC 50S ribosomal protein L5 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q2W2K3|RL5_MAGSA 50S ribosomal protein L5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q2IXP8|RL5_RHOP2 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|A5ELL5|RL5_BRASB 50S ribosomal protein L5 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|A4YSK4|RL5_BRASO 50S ribosomal protein L5 OS=Bradyrhizobium sp. (strain ORS278) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q9ZCR7|RL5_RICPR 50S ribosomal protein L5 OS=Rickettsia prowazekii (strain Madrid E) GN=rplE PE=3 SV=1 14 127 4.0E-13
sp|O67568|RL5_AQUAE 50S ribosomal protein L5 OS=Aquifex aeolicus (strain VF5) GN=rplE PE=3 SV=1 8 133 4.0E-13
sp|Q92QF8|RL5_RHIME 50S ribosomal protein L5 OS=Rhizobium meliloti (strain 1021) GN=rplE PE=3 SV=1 8 133 4.0E-13
sp|Q89J96|RL5_BRADU 50S ribosomal protein L5 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplE PE=3 SV=1 8 133 5.0E-13
sp|C3MAZ2|RL5_RHISN 50S ribosomal protein L5 OS=Rhizobium sp. (strain NGR234) GN=rplE PE=3 SV=1 8 133 6.0E-13
sp|A8GT57|RL5_RICRS 50S ribosomal protein L5 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplE PE=3 SV=1 14 127 6.0E-13
sp|B0BUP8|RL5_RICRO 50S ribosomal protein L5 OS=Rickettsia rickettsii (strain Iowa) GN=rplE PE=3 SV=1 14 127 6.0E-13
sp|P10136|RL5_MYCCT 50S ribosomal protein L5 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplE PE=3 SV=2 10 133 6.0E-13
sp|Q92GX8|RL5_RICCN 50S ribosomal protein L5 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplE PE=3 SV=1 14 127 7.0E-13
sp|C3PP95|RL5_RICAE 50S ribosomal protein L5 OS=Rickettsia africae (strain ESF-5) GN=rplE PE=3 SV=1 14 127 7.0E-13
sp|C4K2G7|RL5_RICPU 50S ribosomal protein L5 OS=Rickettsia peacockii (strain Rustic) GN=rplE PE=3 SV=1 14 127 7.0E-13
sp|Q5WZK0|RL5_LEGPL 50S ribosomal protein L5 OS=Legionella pneumophila (strain Lens) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|A5IHQ2|RL5_LEGPC 50S ribosomal protein L5 OS=Legionella pneumophila (strain Corby) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|Q5X847|RL5_LEGPA 50S ribosomal protein L5 OS=Legionella pneumophila (strain Paris) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|Q5ZYN1|RL5_LEGPH 50S ribosomal protein L5 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|B2FQJ6|RL5_STRMK 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplE PE=3 SV=1 8 133 9.0E-13
sp|B4SKX5|RL5_STRM5 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplE PE=3 SV=1 7 133 9.0E-13
sp|A7HBN0|RL5_ANADF 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplE PE=3 SV=1 8 133 9.0E-13
sp|A7NR51|RL5_ROSCS 50S ribosomal protein L5 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rplE PE=3 SV=1 10 137 9.0E-13
sp|A8EZK4|RL5_RICCK 50S ribosomal protein L5 OS=Rickettsia canadensis (strain McKiel) GN=rplE PE=3 SV=1 14 127 1.0E-12
sp|Q68W90|RL5_RICTY 50S ribosomal protein L5 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplE PE=3 SV=1 14 127 1.0E-12
sp|Q6CZY2|RL5_PECAS 50S ribosomal protein L5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplE PE=3 SV=1 7 133 2.0E-12
sp|A4WFB6|RL5_ENT38 50S ribosomal protein L5 OS=Enterobacter sp. (strain 638) GN=rplE PE=3 SV=1 7 133 2.0E-12
sp|A0PXV8|RL5_CLONN 50S ribosomal protein L5 OS=Clostridium novyi (strain NT) GN=rplE PE=3 SV=1 8 133 2.0E-12
sp|Q9ZI40|RL5_AQUPY 50S ribosomal protein L5 OS=Aquifex pyrophilus GN=rplE PE=3 SV=2 8 133 2.0E-12
sp|Q3SSV4|RL5_NITWN 50S ribosomal protein L5 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplE PE=3 SV=1 8 133 2.0E-12
sp|Q1QN18|RL5_NITHX 50S ribosomal protein L5 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplE PE=3 SV=1 8 133 3.0E-12
sp|Q9PE64|RL5_XYLFA 50S ribosomal protein L5 OS=Xylella fastidiosa (strain 9a5c) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|B0U5L1|RL5_XYLFM 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M12) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|A8GPD8|RL5_RICAH 50S ribosomal protein L5 OS=Rickettsia akari (strain Hartford) GN=rplE PE=3 SV=1 14 127 3.0E-12
sp|C4L7U2|RL5_TOLAT 50S ribosomal protein L5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|Q87E70|RL5_XYLFT 50S ribosomal protein L5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|B2I8I1|RL5_XYLF2 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M23) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|A1AVL2|RL5_RUTMC 50S ribosomal protein L5 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|Q6F1Y2|RL5_MESFL 50S ribosomal protein L5 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplE PE=3 SV=1 10 133 3.0E-12
sp|Q88QM3|RL5_PSEPK 50S ribosomal protein L5 OS=Pseudomonas putida (strain KT2440) GN=rplE PE=3 SV=1 5 133 3.0E-12
sp|B0KK79|RL5_PSEPG 50S ribosomal protein L5 OS=Pseudomonas putida (strain GB-1) GN=rplE PE=3 SV=1 5 133 3.0E-12
sp|A5VXQ9|RL5_PSEP1 50S ribosomal protein L5 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplE PE=3 SV=1 5 133 3.0E-12
sp|Q6A6N8|RL5_PROAC 50S ribosomal protein L5 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|Q820Q9|RL5_NITEU 50S ribosomal protein L5 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplE PE=3 SV=1 10 133 4.0E-12
sp|Q1AU41|RL5_RUBXD 50S ribosomal protein L5 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplE PE=3 SV=1 7 133 4.0E-12
sp|Q4UMR7|RL5_RICFE 50S ribosomal protein L5 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplE PE=3 SV=1 14 127 4.0E-12
sp|B0K5Q5|RL5_THEPX 50S ribosomal protein L5 OS=Thermoanaerobacter sp. (strain X514) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|B0KCL2|RL5_THEP3 50S ribosomal protein L5 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|Q0ANR2|RL5_MARMM 50S ribosomal protein L5 OS=Maricaulis maris (strain MCS10) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|B5XNA5|RL5_KLEP3 50S ribosomal protein L5 OS=Klebsiella pneumoniae (strain 342) GN=rplE PE=3 SV=1 7 133 6.0E-12
sp|A9MN60|RL5_SALAR 50S ribosomal protein L5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplE PE=3 SV=1 7 133 6.0E-12
sp|C5BGL3|RL5_EDWI9 50S ribosomal protein L5 OS=Edwardsiella ictaluri (strain 93-146) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|P62405|RL5_SALTY 50S ribosomal protein L5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplE PE=3 SV=2 1 133 6.0E-12
sp|P62404|RL5_SALTI 50S ribosomal protein L5 OS=Salmonella typhi GN=rplE PE=3 SV=2 1 133 6.0E-12
sp|B4TXD0|RL5_SALSV 50S ribosomal protein L5 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5BGX4|RL5_SALPK 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|C0Q0A4|RL5_SALPC 50S ribosomal protein L5 OS=Salmonella paratyphi C (strain RKS4594) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|A9MSY6|RL5_SALPB 50S ribosomal protein L5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|Q5PIU5|RL5_SALPA 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B4SUS8|RL5_SALNS 50S ribosomal protein L5 OS=Salmonella newport (strain SL254) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B4TKK3|RL5_SALHS 50S ribosomal protein L5 OS=Salmonella heidelberg (strain SL476) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5RH27|RL5_SALG2 50S ribosomal protein L5 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5R279|RL5_SALEP 50S ribosomal protein L5 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5FJK2|RL5_SALDC 50S ribosomal protein L5 OS=Salmonella dublin (strain CT_02021853) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|Q57J44|RL5_SALCH 50S ribosomal protein L5 OS=Salmonella choleraesuis (strain SC-B67) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5F7T3|RL5_SALA4 50S ribosomal protein L5 OS=Salmonella agona (strain SL483) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|Q493J6|RL5_BLOPB 50S ribosomal protein L5 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplE PE=3 SV=1 10 127 7.0E-12
sp|Q1IFV4|RL5_PSEE4 50S ribosomal protein L5 OS=Pseudomonas entomophila (strain L48) GN=rplE PE=3 SV=1 5 133 8.0E-12
sp|Q5NQ53|RL5_ZYMMO 50S ribosomal protein L5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplE PE=3 SV=1 14 133 8.0E-12
sp|Q7VQD6|RL5_BLOFL 50S ribosomal protein L5 OS=Blochmannia floridanus GN=rplE PE=3 SV=1 5 127 8.0E-12
sp|Q2S924|RL5_HAHCH 50S ribosomal protein L5 OS=Hahella chejuensis (strain KCTC 2396) GN=rplE PE=3 SV=1 10 127 9.0E-12
sp|B1JAK0|RL5_PSEPW 50S ribosomal protein L5 OS=Pseudomonas putida (strain W619) GN=rplE PE=3 SV=1 5 133 1.0E-11
sp|A8MLF2|RL5_ALKOO 50S ribosomal protein L5 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplE PE=3 SV=1 14 133 1.0E-11
sp|C5CQ88|RL5_VARPS 50S ribosomal protein L5 OS=Variovorax paradoxus (strain S110) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|B9DM35|RL5_STACT 50S ribosomal protein L5 OS=Staphylococcus carnosus (strain TM300) GN=rplE PE=3 SV=1 3 133 1.0E-11
sp|Q1RHN3|RL5_RICBR 50S ribosomal protein L5 OS=Rickettsia bellii (strain RML369-C) GN=rplE PE=3 SV=1 15 127 1.0E-11
sp|A8GVC6|RL5_RICB8 50S ribosomal protein L5 OS=Rickettsia bellii (strain OSU 85-389) GN=rplE PE=3 SV=1 15 127 1.0E-11
sp|Q9HWE7|RL5_PSEAE 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|Q02T68|RL5_PSEAB 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|B7V656|RL5_PSEA8 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|Q8CRH2|RL5_STAES 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplE PE=3 SV=1 14 133 1.0E-11
sp|Q5HM11|RL5_STAEQ 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplE PE=3 SV=1 14 133 1.0E-11
sp|A1USQ6|RL5_BARBK 50S ribosomal protein L5 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|A0LIK2|RL5_SYNFM 50S ribosomal protein L5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplE PE=3 SV=1 5 133 1.0E-11
sp|Q21M46|RL5_SACD2 50S ribosomal protein L5 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplE PE=3 SV=2 8 133 1.0E-11
sp|Q4L8A2|RL5_STAHJ 50S ribosomal protein L5 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q2NQN4|RL5_SODGM 50S ribosomal protein L5 OS=Sodalis glossinidius (strain morsitans) GN=rplE PE=3 SV=1 10 133 2.0E-11
sp|B4UBB1|RL5_ANASK 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain K) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|Q2IJ79|RL5_ANADE 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|B8J872|RL5_ANAD2 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|B1W3Z5|RL5_STRGG 50S ribosomal protein L5 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|Q5LW46|RL5_RUEPO 50S ribosomal protein L5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|O52344|RL5_MYCGA 50S ribosomal protein L5 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rplE PE=3 SV=1 10 142 2.0E-11
sp|A6UZK0|RL5_PSEA7 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain PA7) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|Q5WLQ0|RL5_BACSK 50S ribosomal protein L5 OS=Bacillus clausii (strain KSM-K16) GN=rplE PE=3 SV=1 3 133 2.0E-11
sp|A1WVB0|RL5_HALHL 50S ribosomal protein L5 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplE PE=3 SV=1 7 133 2.0E-11
sp|Q7A083|RL5_STAAW 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MW2) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A8Z345|RL5_STAAT 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q6G783|RL5_STAAS 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MSSA476) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q6GEJ5|RL5_STAAR 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MRSA252) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q7A465|RL5_STAAN 50S ribosomal protein L5 OS=Staphylococcus aureus (strain N315) GN=rplE PE=1 SV=1 14 133 2.0E-11
sp|Q99S33|RL5_STAAM 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A6QJ80|RL5_STAAE 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Newman) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q5HDX0|RL5_STAAC 50S ribosomal protein L5 OS=Staphylococcus aureus (strain COL) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q2YYK9|RL5_STAAB 50S ribosomal protein L5 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A5IV22|RL5_STAA9 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH9) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q2FW18|RL5_STAA8 50S ribosomal protein L5 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplE PE=1 SV=1 14 133 2.0E-11
sp|Q2FEQ1|RL5_STAA3 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A6U3W3|RL5_STAA2 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH1) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A7X5E5|RL5_STAA1 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|C1DKM5|RL5_AZOVD 50S ribosomal protein L5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|B2A4F1|RL5_NATTJ 50S ribosomal protein L5 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplE PE=3 SV=1 8 150 2.0E-11
sp|A8LM69|RL5_DINSH 50S ribosomal protein L5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplE PE=3 SV=1 8 137 2.0E-11
sp|Q0AII4|RL5_NITEC 50S ribosomal protein L5 OS=Nitrosomonas eutropha (strain C91) GN=rplE PE=3 SV=1 10 118 2.0E-11
sp|B3CN38|RL5_WOLPP 50S ribosomal protein L5 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rplE PE=3 SV=1 7 127 3.0E-11
sp|Q2G8W8|RL5_NOVAD 50S ribosomal protein L5 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplE PE=3 SV=1 8 133 3.0E-11
sp|C5BQ73|RL5_TERTT 50S ribosomal protein L5 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplE PE=3 SV=1 8 133 3.0E-11
sp|A1KB15|RL5_AZOSB 50S ribosomal protein L5 OS=Azoarcus sp. (strain BH72) GN=rplE PE=3 SV=1 10 133 4.0E-11
sp|Q82DN3|RL5_STRAW 50S ribosomal protein L5 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|Q47J91|RL5_DECAR 50S ribosomal protein L5 OS=Dechloromonas aromatica (strain RCB) GN=rplE PE=3 SV=1 10 133 4.0E-11
sp|A9KJI2|RL5_CLOPH 50S ribosomal protein L5 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|Q65QW7|RL5_MANSM 50S ribosomal protein L5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplE PE=3 SV=1 10 133 4.0E-11
sp|A1TYK9|RL5_MARHV 50S ribosomal protein L5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|A1T0D0|RL5_PSYIN 50S ribosomal protein L5 OS=Psychromonas ingrahamii (strain 37) GN=rplE PE=3 SV=1 10 127 4.0E-11
sp|A1B039|RL5_PARDP 50S ribosomal protein L5 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|A6W380|RL5_MARMS 50S ribosomal protein L5 OS=Marinomonas sp. (strain MWYL1) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|Q1WSA2|RL5_LACS1 50S ribosomal protein L5 OS=Lactobacillus salivarius (strain UCC118) GN=rplE PE=3 SV=1 10 133 5.0E-11
sp|Q1GPB1|RL5_SPHAL 50S ribosomal protein L5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplE PE=3 SV=1 8 133 5.0E-11
sp|Q5P320|RL5_AROAE 50S ribosomal protein L5 OS=Aromatoleum aromaticum (strain EbN1) GN=rplE PE=3 SV=1 10 141 5.0E-11
sp|A7GK32|RL5_BACCN 50S ribosomal protein L5 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplE PE=3 SV=1 10 133 5.0E-11
sp|A5CXL6|RL5_VESOH 50S ribosomal protein L5 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplE PE=3 SV=1 7 133 5.0E-11
sp|B7VLE5|RL5_VIBTL 50S ribosomal protein L5 OS=Vibrio tasmaniensis (strain LGP32) GN=rplE PE=3 SV=1 10 127 6.0E-11
sp|A4SSZ4|RL5_AERS4 50S ribosomal protein L5 OS=Aeromonas salmonicida (strain A449) GN=rplE PE=3 SV=1 10 127 6.0E-11
sp|A0KF33|RL5_AERHH 50S ribosomal protein L5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplE PE=3 SV=1 10 127 7.0E-11
sp|P38517|RL5_THEMA 50S ribosomal protein L5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplE PE=3 SV=2 14 142 7.0E-11
sp|Q31IX0|RL5_THICR 50S ribosomal protein L5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplE PE=3 SV=1 10 133 7.0E-11
sp|Q5FTZ5|RL5_GLUOX 50S ribosomal protein L5 OS=Gluconobacter oxydans (strain 621H) GN=rplE PE=3 SV=1 8 127 7.0E-11
sp|A5USH7|RL5_ROSS1 50S ribosomal protein L5 OS=Roseiflexus sp. (strain RS-1) GN=rplE PE=3 SV=1 10 137 7.0E-11
sp|C4ZBT1|RL5_EUBR3 50S ribosomal protein L5 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rplE PE=3 SV=1 8 133 8.0E-11
sp|B1LBM8|RL5_THESQ 50S ribosomal protein L5 OS=Thermotoga sp. (strain RQ2) GN=rplE PE=3 SV=1 14 142 8.0E-11
sp|Q0SQF6|RL5_CLOPS 50S ribosomal protein L5 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplE PE=3 SV=1 8 127 8.0E-11
sp|Q8XHT5|RL5_CLOPE 50S ribosomal protein L5 OS=Clostridium perfringens (strain 13 / Type A) GN=rplE PE=3 SV=1 8 127 8.0E-11
sp|Q0TMQ8|RL5_CLOP1 50S ribosomal protein L5 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplE PE=3 SV=1 8 127 8.0E-11
sp|A4IZS2|RL5_FRATW 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|Q0BNR5|RL5_FRATO 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|A0Q4J5|RL5_FRATN 50S ribosomal protein L5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|Q2A5F8|RL5_FRATH 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|A7N9T7|RL5_FRATF 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|B2SDX3|RL5_FRATM 50S ribosomal protein L5 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|Q3J8S6|RL5_NITOC 50S ribosomal protein L5 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplE PE=3 SV=1 14 133 8.0E-11
sp|Q5NHV6|RL5_FRATT 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplE PE=3 SV=1 7 133 9.0E-11
sp|Q14JA8|RL5_FRAT1 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplE PE=3 SV=1 7 133 9.0E-11
sp|Q9Z9K2|RL5_BACHD 50S ribosomal protein L5 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplE PE=3 SV=1 14 133 9.0E-11
sp|B9DSW2|RL5_STRU0 50S ribosomal protein L5 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rplE PE=3 SV=1 3 133 9.0E-11
sp|Q8R7W6|RL5_CALS4 50S ribosomal protein L5 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplE PE=3 SV=1 8 133 9.0E-11
sp|C0Q9W1|RL5_DESAH 50S ribosomal protein L5 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplE PE=3 SV=1 8 133 9.0E-11
sp|B1MW02|RL5_LEUCK 50S ribosomal protein L5 OS=Leuconostoc citreum (strain KM20) GN=rplE PE=3 SV=1 4 133 9.0E-11
sp|Q890P8|RL5_CLOTE 50S ribosomal protein L5 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplE PE=3 SV=1 8 133 9.0E-11
sp|C0R2Z7|RL5_WOLWR 50S ribosomal protein L5 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rplE PE=3 SV=1 8 127 9.0E-11
sp|Q73H98|RL5_WOLPM 50S ribosomal protein L5 OS=Wolbachia pipientis wMel GN=rplE PE=3 SV=1 8 127 9.0E-11
sp|A4VHP2|RL5_PSEU5 50S ribosomal protein L5 OS=Pseudomonas stutzeri (strain A1501) GN=rplE PE=3 SV=1 8 133 1.0E-10
sp|B0UX26|RL5_HISS2 50S ribosomal protein L5 OS=Histophilus somni (strain 2336) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q0I150|RL5_HAES1 50S ribosomal protein L5 OS=Haemophilus somnus (strain 129Pt) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B1YGW2|RL5_EXIS2 50S ribosomal protein L5 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B5YDV5|RL5_DICT6 50S ribosomal protein L5 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplE PE=3 SV=1 8 133 1.0E-10
sp|P44346|RL5_HAEIN 50S ribosomal protein L5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplE PE=3 SV=2 10 133 1.0E-10
sp|A5UHU3|RL5_HAEIG 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittGG) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A5UDT5|RL5_HAEIE 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittEE) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q4QMA9|RL5_HAEI8 50S ribosomal protein L5 OS=Haemophilus influenzae (strain 86-028NP) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B0BSU3|RL5_ACTPJ 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B3GZ23|RL5_ACTP7 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A3N369|RL5_ACTP2 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7GNC8|RL5_BIFLS 50S ribosomal protein L5 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplE PE=3 SV=1 5 110 1.0E-10
sp|Q8G406|RL5_BIFLO 50S ribosomal protein L5 OS=Bifidobacterium longum (strain NCC 2705) GN=rplE PE=3 SV=1 5 110 1.0E-10
sp|B3DQC6|RL5_BIFLD 50S ribosomal protein L5 OS=Bifidobacterium longum (strain DJO10A) GN=rplE PE=3 SV=1 5 110 1.0E-10
sp|B8F6Q9|RL5_HAEPS 50S ribosomal protein L5 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q81VR8|RL5_BACAN 50S ribosomal protein L5 OS=Bacillus anthracis GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C3LJ94|RL5_BACAC 50S ribosomal protein L5 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C3P9R7|RL5_BACAA 50S ribosomal protein L5 OS=Bacillus anthracis (strain A0248) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A9KWB4|RL5_SHEB9 50S ribosomal protein L5 OS=Shewanella baltica (strain OS195) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A6WHU0|RL5_SHEB8 50S ribosomal protein L5 OS=Shewanella baltica (strain OS185) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A3DA60|RL5_SHEB5 50S ribosomal protein L5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B8EBJ3|RL5_SHEB2 50S ribosomal protein L5 OS=Shewanella baltica (strain OS223) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q9CL42|RL5_PASMU 50S ribosomal protein L5 OS=Pasteurella multocida (strain Pm70) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q6HPP6|RL5_BACHK 50S ribosomal protein L5 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q63H78|RL5_BACCZ 50S ribosomal protein L5 OS=Bacillus cereus (strain ZK / E33L) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q81J30|RL5_BACCR 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7HJ60|RL5_BACC4 50S ribosomal protein L5 OS=Bacillus cereus (strain B4264) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C1ET51|RL5_BACC3 50S ribosomal protein L5 OS=Bacillus cereus (strain 03BB102) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7JKD1|RL5_BACC0 50S ribosomal protein L5 OS=Bacillus cereus (strain AH820) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A0R8J2|RL5_BACAH 50S ribosomal protein L5 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A6VLK0|RL5_ACTSZ 50S ribosomal protein L5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B9IZK6|RL5_BACCQ 50S ribosomal protein L5 OS=Bacillus cereus (strain Q1) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7HQV6|RL5_BACC7 50S ribosomal protein L5 OS=Bacillus cereus (strain AH187) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q73F84|RL5_BACC1 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q28UU2|RL5_JANSC 50S ribosomal protein L5 OS=Jannaschia sp. (strain CCS1) GN=rplE PE=3 SV=1 8 133 1.0E-10
sp|A3Q994|RL5_SHELP 50S ribosomal protein L5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C3LRP6|RL5_VIBCM 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q9KNZ6|RL5_VIBCH 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A5F554|RL5_VIBC3 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q7VKE5|RL5_HAEDU 50S ribosomal protein L5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A8F4S3|RL5_PSELT 50S ribosomal protein L5 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplE PE=3 SV=1 14 133 1.0E-10
sp|Q3YRM1|RL5_EHRCJ 50S ribosomal protein L5 OS=Ehrlichia canis (strain Jake) GN=rplE PE=3 SV=1 7 127 1.0E-10
sp|Q2GL47|RL5_ANAPZ 50S ribosomal protein L5 OS=Anaplasma phagocytophilum (strain HZ) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q97EJ0|RL5_CLOAB 50S ribosomal protein L5 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rplE PE=3 SV=1 8 127 2.0E-10
sp|Q5L411|RL5_GEOKA 50S ribosomal protein L5 OS=Geobacillus kaustophilus (strain HTA426) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|C4KZN4|RL5_EXISA 50S ribosomal protein L5 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|Q03PW9|RL5_LACBA 50S ribosomal protein L5 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|A7N0I9|RL5_VIBCB 50S ribosomal protein L5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|A9VP89|RL5_BACWK 50S ribosomal protein L5 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|Q8ETX1|RL5_OCEIH 50S ribosomal protein L5 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplE PE=3 SV=1 7 150 2.0E-10
sp|B5FG21|RL5_VIBFM 50S ribosomal protein L5 OS=Vibrio fischeri (strain MJ11) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|A1S230|RL5_SHEAM 50S ribosomal protein L5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|B1KMX1|RL5_SHEWM 50S ribosomal protein L5 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|B7IT31|RL5_BACC2 50S ribosomal protein L5 OS=Bacillus cereus (strain G9842) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|A5N4Q9|RL5_CLOK5 50S ribosomal protein L5 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|B9DYC1|RL5_CLOK1 50S ribosomal protein L5 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q5GSV6|RL5_WOLTR 50S ribosomal protein L5 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rplE PE=3 SV=1 8 127 2.0E-10
sp|A1W320|RL5_ACISJ 50S ribosomal protein L5 OS=Acidovorax sp. (strain JS42) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|B9MBU9|RL5_ACIET 50S ribosomal protein L5 OS=Acidovorax ebreus (strain TPSY) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|Q9L0C8|RL5_STRCO 50S ribosomal protein L5 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q5E8A2|RL5_VIBF1 50S ribosomal protein L5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplE PE=3 SV=1 10 128 2.0E-10
sp|Q2RFQ9|RL5_MOOTA 50S ribosomal protein L5 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q489A1|RL5_COLP3 50S ribosomal protein L5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|B8E1E5|RL5_DICTD 50S ribosomal protein L5 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q0VSJ1|RL5_ALCBS 50S ribosomal protein L5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|A1WKA4|RL5_VEREI 50S ribosomal protein L5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|A8GYY8|RL5_SHEPA 50S ribosomal protein L5 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|B0TM00|RL5_SHEHH 50S ribosomal protein L5 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|B1KSL3|RL5_CLOBM 50S ribosomal protein L5 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|B6EPT7|RL5_ALISL 50S ribosomal protein L5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplE PE=3 SV=1 10 127 3.0E-10
sp|Q6AP59|RL5_DESPS 50S ribosomal protein L5 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplE PE=3 SV=1 8 118 3.0E-10
sp|Q2GH44|RL5_EHRCR 50S ribosomal protein L5 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rplE PE=3 SV=1 7 127 3.0E-10
sp|P33098|RL5_MICLU 50S ribosomal protein L5 OS=Micrococcus luteus GN=rplE PE=3 SV=1 8 133 3.0E-10
sp|A5EX87|RL5_DICNV 50S ribosomal protein L5 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplE PE=3 SV=1 8 127 3.0E-10
sp|Q089P2|RL5_SHEFN 50S ribosomal protein L5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplE PE=3 SV=1 10 133 3.0E-10
sp|Q250M0|RL5_DESHY 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain Y51) GN=rplE PE=3 SV=1 8 133 3.0E-10
sp|B8CNE5|RL5_SHEPW 50S ribosomal protein L5 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplE PE=3 SV=1 10 127 3.0E-10
sp|B8G1X8|RL5_DESHD 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplE PE=3 SV=1 8 133 3.0E-10
sp|B7GJ79|RL5_ANOFW 50S ribosomal protein L5 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplE PE=3 SV=1 10 133 3.0E-10
sp|A8G1D6|RL5_SHESH 50S ribosomal protein L5 OS=Shewanella sediminis (strain HAW-EB3) GN=rplE PE=3 SV=1 10 127 3.0E-10
sp|A4IJK0|RL5_GEOTN 50S ribosomal protein L5 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplE PE=3 SV=1 10 133 3.0E-10
sp|P08895|RL5_GEOSE 50S ribosomal protein L5 OS=Geobacillus stearothermophilus GN=rplE PE=1 SV=1 10 133 3.0E-10
sp|Q49ZF6|RL5_STAS1 50S ribosomal protein L5 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplE PE=3 SV=1 14 133 3.0E-10
sp|Q839F2|RL5_ENTFA 50S ribosomal protein L5 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplE PE=3 SV=1 10 150 3.0E-10
sp|Q8EK57|RL5_SHEON 50S ribosomal protein L5 OS=Shewanella oneidensis (strain MR-1) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|A4XZ78|RL5_PSEMY 50S ribosomal protein L5 OS=Pseudomonas mendocina (strain ymp) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|A0KRN6|RL5_SHESA 50S ribosomal protein L5 OS=Shewanella sp. (strain ANA-3) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|Q0I093|RL5_SHESR 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-7) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|Q0HNS5|RL5_SHESM 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-4) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|B2GJ05|RL5_KOCRD 50S ribosomal protein L5 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rplE PE=3 SV=1 8 110 4.0E-10
sp|Q03IG3|RL5_STRTD 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplE PE=3 SV=1 14 133 4.0E-10
sp|C3K2W4|RL5_PSEFS 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain SBW25) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q5QXX0|RL5_IDILO 50S ribosomal protein L5 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplE PE=3 SV=1 7 127 4.0E-10
sp|C5CC50|RL5_MICLC 50S ribosomal protein L5 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplE PE=3 SV=1 8 133 4.0E-10
sp|Q87T01|RL5_VIBPA 50S ribosomal protein L5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|Q1R0G3|RL5_CHRSD 50S ribosomal protein L5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplE PE=3 SV=1 8 133 4.0E-10
sp|P12877|RL5_BACSU 50S ribosomal protein L5 OS=Bacillus subtilis (strain 168) GN=rplE PE=1 SV=1 10 133 4.0E-10
sp|Q02W36|RL5_LACLS 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplE PE=3 SV=1 14 150 4.0E-10
sp|A2RNP3|RL5_LACLM 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplE PE=3 SV=1 14 150 4.0E-10
sp|Q9CDX4|RL5_LACLA 50S ribosomal protein L5 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplE PE=3 SV=1 14 150 4.0E-10
sp|Q4ZMQ6|RL5_PSEU2 50S ribosomal protein L5 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q48D48|RL5_PSE14 50S ribosomal protein L5 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|A7Z0Q0|RL5_BACMF 50S ribosomal protein L5 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplE PE=3 SV=1 10 133 4.0E-10
sp|Q3K600|RL5_PSEPF 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q4K545|RL5_PSEF5 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q65P95|RL5_BACLD 50S ribosomal protein L5 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|Q5M2C5|RL5_STRT2 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q5LXS3|RL5_STRT1 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q8E2C2|RL5_STRA5 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q8E7S9|RL5_STRA3 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q3K3V7|RL5_STRA1 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q12G91|RL5_POLSJ 50S ribosomal protein L5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rplE PE=3 SV=1 7 133 5.0E-10
sp|B2TII7|RL5_CLOBB 50S ribosomal protein L5 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplE PE=3 SV=1 8 133 5.0E-10
sp|B2UYC2|RL5_CLOBA 50S ribosomal protein L5 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplE PE=3 SV=1 8 133 5.0E-10
sp|A1A081|RL5_BIFAA 50S ribosomal protein L5 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rplE PE=3 SV=1 7 110 5.0E-10
sp|B8I7Z1|RL5_CLOCE 50S ribosomal protein L5 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|A1REC6|RL5_SHESW 50S ribosomal protein L5 OS=Shewanella sp. (strain W3-18-1) GN=rplE PE=3 SV=1 10 127 5.0E-10
sp|A4YBX1|RL5_SHEPC 50S ribosomal protein L5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplE PE=3 SV=1 10 127 5.0E-10
sp|Q21QN5|RL5_RHOFT 50S ribosomal protein L5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplE PE=3 SV=1 1 133 5.0E-10
sp|A8F997|RL5_BACP2 50S ribosomal protein L5 OS=Bacillus pumilus (strain SAFR-032) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|B1HMW8|RL5_LYSSC 50S ribosomal protein L5 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|C0QW08|RL5_BRAHW 50S ribosomal protein L5 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplE PE=3 SV=1 14 141 5.0E-10
sp|C0MCC2|RL5_STRS7 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|P0DE57|RL5_STRPQ 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q48VT7|RL5_STRPM 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|A2RC26|RL5_STRPG 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1J901|RL5_STRPF 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1JJ50|RL5_STRPD 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1JP05|RL5_STRPC 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1JE46|RL5_STRPB 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q7CNP5|RL5_STRP8 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q5XEC3|RL5_STRP6 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|P0DE56|RL5_STRP3 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q9A1W2|RL5_STRP1 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M1 GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|B4U512|RL5_STREM 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|C0M9H3|RL5_STRE4 50S ribosomal protein L5 OS=Streptococcus equi subsp. equi (strain 4047) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|A1VJ27|RL5_POLNA 50S ribosomal protein L5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplE PE=3 SV=1 7 133 6.0E-10
sp|Q2YAY5|RL5_NITMU 50S ribosomal protein L5 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplE PE=3 SV=1 14 133 6.0E-10
sp|A1TJS9|RL5_ACIAC 50S ribosomal protein L5 OS=Acidovorax citrulli (strain AAC00-1) GN=rplE PE=3 SV=1 7 133 6.0E-10
sp|B5XJ48|RL5_STRPZ 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rplE PE=3 SV=1 14 133 6.0E-10
sp|B0U0X7|RL5_FRAP2 50S ribosomal protein L5 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplE PE=3 SV=1 7 133 6.0E-10
sp|Q8K962|RL5_BUCAP 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplE PE=3 SV=1 10 141 7.0E-10
sp|Q3SLN7|RL5_THIDA 50S ribosomal protein L5 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplE PE=3 SV=1 10 133 7.0E-10
sp|Q889V9|RL5_PSESM 50S ribosomal protein L5 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplE PE=3 SV=1 5 133 7.0E-10
sp|C6DG62|RL5_PECCP 50S ribosomal protein L5 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplE PE=3 SV=1 1 133 7.0E-10
sp|A4VSG6|RL5_STRSY 50S ribosomal protein L5 OS=Streptococcus suis (strain 05ZYH33) GN=rplE PE=3 SV=1 14 133 7.0E-10
sp|A4VYQ5|RL5_STRS2 50S ribosomal protein L5 OS=Streptococcus suis (strain 98HAH33) GN=rplE PE=3 SV=1 14 133 7.0E-10
sp|C5D3S9|RL5_GEOSW 50S ribosomal protein L5 OS=Geobacillus sp. (strain WCH70) GN=rplE PE=3 SV=1 10 133 7.0E-10
sp|Q7MYG3|RL5_PHOLL 50S ribosomal protein L5 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplE PE=3 SV=1 7 133 8.0E-10
sp|Q2LQA8|RL5_SYNAS 50S ribosomal protein L5 OS=Syntrophus aciditrophicus (strain SB) GN=rplE PE=3 SV=1 8 127 8.0E-10
sp|B9KLA3|RL5_RHOSK 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplE PE=3 SV=1 8 133 8.0E-10
sp|Q3J5R0|RL5_RHOS4 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplE PE=3 SV=1 8 133 8.0E-10
sp|A1JS20|RL5_YERE8 50S ribosomal protein L5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplE PE=3 SV=1 1 133 9.0E-10
sp|Q12SU7|RL5_SHEDO 50S ribosomal protein L5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplE PE=3 SV=1 7 127 9.0E-10
sp|Q04G73|RL5_OENOB 50S ribosomal protein L5 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplE PE=3 SV=1 10 133 9.0E-10
sp|A3PGM3|RL5_RHOS1 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplE PE=3 SV=1 8 133 9.0E-10
sp|Q5PA70|RL5_ANAMM 50S ribosomal protein L5 OS=Anaplasma marginale (strain St. Maries) GN=rplE PE=3 SV=1 1 127 1.0E-09
sp|B9KJ58|RL5_ANAMF 50S ribosomal protein L5 OS=Anaplasma marginale (strain Florida) GN=rplE PE=3 SV=1 1 127 1.0E-09
sp|Q3IJJ7|RL5_PSEHT 50S ribosomal protein L5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplE PE=3 SV=1 15 127 1.0E-09
sp|A7GJ62|RL5_CLOBL 50S ribosomal protein L5 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|B1IGE2|RL5_CLOBK 50S ribosomal protein L5 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|C1FMT9|RL5_CLOBJ 50S ribosomal protein L5 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|A5I7J4|RL5_CLOBH 50S ribosomal protein L5 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|C3KVN9|RL5_CLOB6 50S ribosomal protein L5 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|A7FZ57|RL5_CLOB1 50S ribosomal protein L5 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|A5V5Z0|RL5_SPHWW 50S ribosomal protein L5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|Q1QDH4|RL5_PSYCK 50S ribosomal protein L5 OS=Psychrobacter cryohalolentis (strain K5) GN=rplE PE=3 SV=1 8 127 1.0E-09
sp|C1CPA0|RL5_STRZT 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|C1CIA9|RL5_STRZP 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain P1031) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|C1CC18|RL5_STRZJ 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain JJA) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|Q8CWV4|RL5_STRR6 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B2IS52|RL5_STRPS 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|Q97SV1|RL5_STRPN 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B8ZKG9|RL5_STRPJ 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B1I8L0|RL5_STRPI 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|C1CAM4|RL5_STRP7 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain 70585) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B5E6G7|RL5_STRP4 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|Q04MM4|RL5_STRP2 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B1I1K0|RL5_DESAP 50S ribosomal protein L5 OS=Desulforudis audaxviator (strain MP104C) GN=rplE PE=3 SV=1 1 128 1.0E-09
sp|Q6AD07|RL5_LEIXX 50S ribosomal protein L5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplE PE=3 SV=1 17 133 1.0E-09
sp|B4RT40|RL5_ALTMD 50S ribosomal protein L5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplE PE=3 SV=1 10 127 1.0E-09
sp|Q8DS25|RL5_STRMU 50S ribosomal protein L5 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B8D837|RL5_BUCAT 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplE PE=3 SV=1 10 133 1.0E-09
sp|P57579|RL5_BUCAI 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplE PE=3 SV=1 10 133 1.0E-09
sp|B8D9T5|RL5_BUCA5 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplE PE=3 SV=1 10 133 1.0E-09
sp|B2VK52|RL5_ERWT9 50S ribosomal protein L5 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplE PE=3 SV=1 1 133 1.0E-09
sp|P46178|RL5_BUCAK 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplE PE=3 SV=1 1 133 1.0E-09
sp|Q4FUE4|RL5_PSYA2 50S ribosomal protein L5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplE PE=3 SV=1 8 127 1.0E-09
sp|Q74L78|RL5_LACJO 50S ribosomal protein L5 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|Q7VTB9|RL5_BORPE 50S ribosomal protein L5 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q7W2E3|RL5_BORPA 50S ribosomal protein L5 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q7WRB1|RL5_BORBR 50S ribosomal protein L5 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q046B3|RL5_LACGA 50S ribosomal protein L5 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|A9NEE5|RL5_ACHLI 50S ribosomal protein L5 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q6LVA4|RL5_PHOPR 50S ribosomal protein L5 OS=Photobacterium profundum GN=rplE PE=3 SV=1 10 127 2.0E-09
sp|Q1LTC6|RL5_BAUCH 50S ribosomal protein L5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q3A9S8|RL5_CARHZ 50S ribosomal protein L5 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplE PE=3 SV=1 8 133 2.0E-09
sp|A7MPH6|RL5_CROS8 50S ribosomal protein L5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|A6LPS3|RL5_CLOB8 50S ribosomal protein L5 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplE PE=3 SV=1 8 133 2.0E-09
sp|A3CK75|RL5_STRSV 50S ribosomal protein L5 OS=Streptococcus sanguinis (strain SK36) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|Q7NEG4|RL5_GLOVI 50S ribosomal protein L5 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplE PE=3 SV=1 7 133 2.0E-09
sp|A5WCK2|RL5_PSYWF 50S ribosomal protein L5 OS=Psychrobacter sp. (strain PRwf-1) GN=rplE PE=3 SV=1 8 127 2.0E-09
sp|Q7MPH6|RL5_VIBVY 50S ribosomal protein L5 OS=Vibrio vulnificus (strain YJ016) GN=rplE PE=3 SV=1 10 127 2.0E-09
sp|Q8DE51|RL5_VIBVU 50S ribosomal protein L5 OS=Vibrio vulnificus (strain CMCP6) GN=rplE PE=3 SV=2 10 127 2.0E-09
sp|A8AZL3|RL5_STRGC 50S ribosomal protein L5 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|B3WAK5|RL5_LACCB 50S ribosomal protein L5 OS=Lactobacillus casei (strain BL23) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q034Z5|RL5_LACC3 50S ribosomal protein L5 OS=Lactobacillus casei (strain ATCC 334) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q3YWV1|RL5_SHISS 50S ribosomal protein L5 OS=Shigella sonnei (strain Ss046) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q0SZZ4|RL5_SHIF8 50S ribosomal protein L5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q32B43|RL5_SHIDS 50S ribosomal protein L5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q31VW8|RL5_SHIBS 50S ribosomal protein L5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B2U2S6|RL5_SHIB3 50S ribosomal protein L5 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|A6TEW0|RL5_KLEP7 50S ribosomal protein L5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B7LRS4|RL5_ESCF3 50S ribosomal protein L5 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q1R620|RL5_ECOUT 50S ribosomal protein L5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B1LHC2|RL5_ECOSM 50S ribosomal protein L5 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B6I222|RL5_ECOSE 50S ribosomal protein L5 OS=Escherichia coli (strain SE11) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B7NDS9|RL5_ECOLU 50S ribosomal protein L5 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplE PE=3 SV=1 1 133 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4916
MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNEKIAVHVTVRGP
KAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPSIGIYGMDFYCCMTRPGERVTRRRRMKARIG
SSHRIKRDETVKWFKQRFDGIVR*
Coding >OphauB2|4916
ATGGCTTCCGAAAAGGCAAACAACCCCATGCGGGAGCTCAAGATTCAGAAACTTGTTCTGAATATTTCCGTCGGC
GAGTCTGGTGACAGACTGACCCGAGCCGCCAAGGTGCTCGAGCAGTTGTCGGGTCAAACACCCGTCTACAGCAAG
GCTCGCTACACCGTCCGTACCTTTGGTATTCGTCGTAACGAAAAGATTGCTGTCCACGTTACTGTCCGAGGCCCC
AAGGCCGAGGAGATTCTCGAACGTGGCCTCAAGGTCAAGGAATATGAGCTTCGCAAGCGCAACTTTTCCGAGACG
GGCAACTTTGGATTTGGCATCAGCGAACACATTGACCTTGGTATCAAGTACGACCCCTCGATTGGTATCTACGGC
ATGGACTTTTACTGCTGCATGACCCGGCCTGGTGAGCGCGTCACTCGCCGCCGTCGCATGAAGGCCAGAATTGGG
TCCAGCCACCGCATCAAGCGCGACGAGACTGTCAAGTGGTTCAAGCAGCGTTTCGACGGCATTGTCCGGTAG
Transcript >OphauB2|4916
ATGGCTTCCGAAAAGGCAAACAACCCCATGCGGGAGCTCAAGATTCAGAAACTTGTTCTGAATATTTCCGTCGGC
GAGTCTGGTGACAGACTGACCCGAGCCGCCAAGGTGCTCGAGCAGTTGTCGGGTCAAACACCCGTCTACAGCAAG
GCTCGCTACACCGTCCGTACCTTTGGTATTCGTCGTAACGAAAAGATTGCTGTCCACGTTACTGTCCGAGGCCCC
AAGGCCGAGGAGATTCTCGAACGTGGCCTCAAGGTCAAGGAATATGAGCTTCGCAAGCGCAACTTTTCCGAGACG
GGCAACTTTGGATTTGGCATCAGCGAACACATTGACCTTGGTATCAAGTACGACCCCTCGATTGGTATCTACGGC
ATGGACTTTTACTGCTGCATGACCCGGCCTGGTGAGCGCGTCACTCGCCGCCGTCGCATGAAGGCCAGAATTGGG
TCCAGCCACCGCATCAAGCGCGACGAGACTGTCAAGTGGTTCAAGCAGCGTTTCGACGGCATTGTCCGGTAG
Gene >OphauB2|4916
ATGGCTTCCGAAAAGGCAAACAACCCCATGCGGGAGCTCAAGATTCAGAAACTTGTTCTGAATATTTCCGTCGGC
GAGTCTGGTGACAGACTGACCCGAGCCGCCAAGGTGCTCGAGCAGTTGTCGGGTCAAACACCCGTCTACAGTACG
TTGTGTCTGATTATCGATACAACATGCAATCTAACCTTGACTTTTCAGGCAAGGCTCGCTACACCGTCCGTACCT
TTGGTATTCGTCGTAACGAAAAGATTGCTGTCCACGTTACTGTCCGAGGCCCCAAGGTACGCCGCCAAAGCTTGC
TCGCAGCATCGTTTACAAGGCTTTAATACTAACGAGGCATCCTACAGGCCGAGGAGATTCTCGAACGTGGCCTCA
AGGTCAAGGAATATGAGCTTCGCAAGCGCAACTTTTCCGAGACGGGCAACTTTGGATTTGGCATCAGCGAACACA
TTGACCTTGGTATCAAGTACGACCCCTCGATTGGTATCTACGGCATGGACTTTTACTGCTGCATGACCCGGCCTG
GTGAGCGCGTCACTCGCCGCCGTCGCATGAAGGCCAGAATTGGGTCCAGCCACCGCATCAAGCGCGACGAGACTG
TCAAGTGGTTCAAGCAGCGTTTCGACGGCATTGTCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail