Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|491
Gene name
LocationContig_108:25441..27038
Strand+
Gene length (bp)1597
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 5.2E-18 67 416
PF07969 Amidohydro_3 Amidohydrolase family 1.6E-07 372 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y303|NAGA_HUMAN Putative N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens GN=AMDHD2 PE=1 SV=2 17 410 3.0E-92
sp|Q8JZV7|NAGA_MOUSE Putative N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus GN=Amdhd2 PE=1 SV=1 17 410 5.0E-90
sp|Q5BJY6|NAGA_RAT Putative N-acetylglucosamine-6-phosphate deacetylase OS=Rattus norvegicus GN=Amdhd2 PE=3 SV=2 17 410 2.0E-89
sp|A7MBC0|NAGA_BOVIN Putative N-acetylglucosamine-6-phosphate deacetylase OS=Bos taurus GN=AMDHD2 PE=2 SV=1 15 410 1.0E-88
sp|Q6P0U0|NAGA_DANRE Putative N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio GN=amdhd2 PE=2 SV=1 15 433 2.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y303|NAGA_HUMAN Putative N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens GN=AMDHD2 PE=1 SV=2 17 410 3.0E-92
sp|Q8JZV7|NAGA_MOUSE Putative N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus GN=Amdhd2 PE=1 SV=1 17 410 5.0E-90
sp|Q5BJY6|NAGA_RAT Putative N-acetylglucosamine-6-phosphate deacetylase OS=Rattus norvegicus GN=Amdhd2 PE=3 SV=2 17 410 2.0E-89
sp|A7MBC0|NAGA_BOVIN Putative N-acetylglucosamine-6-phosphate deacetylase OS=Bos taurus GN=AMDHD2 PE=2 SV=1 15 410 1.0E-88
sp|Q6P0U0|NAGA_DANRE Putative N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio GN=amdhd2 PE=2 SV=1 15 433 2.0E-88
sp|Q9VR81|NAGA_DROME Putative N-acetylglucosamine-6-phosphate deacetylase OS=Drosophila melanogaster GN=CG17065 PE=2 SV=1 15 432 1.0E-84
sp|P34480|NAGA_CAEEL Putative N-acetylglucosamine-6-phosphate deacetylase OS=Caenorhabditis elegans GN=F59B2.3 PE=3 SV=1 13 411 5.0E-80
sp|O32445|NAGA_VIBCH N-acetylglucosamine-6-phosphate deacetylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nagA PE=1 SV=2 18 411 2.0E-46
sp|Q84F86|NAGA_LYSSH N-acetylglucosamine-6-phosphate deacetylase OS=Lysinibacillus sphaericus GN=nagA PE=2 SV=1 65 410 5.0E-43
sp|O34450|NAGA_BACSU N-acetylglucosamine-6-phosphate deacetylase OS=Bacillus subtilis (strain 168) GN=nagA PE=1 SV=1 67 409 4.0E-42
sp|P0AF18|NAGA_ECOLI N-acetylglucosamine-6-phosphate deacetylase OS=Escherichia coli (strain K12) GN=nagA PE=1 SV=1 18 411 2.0E-39
sp|P0AF19|NAGA_ECO57 N-acetylglucosamine-6-phosphate deacetylase OS=Escherichia coli O157:H7 GN=nagA PE=3 SV=1 18 411 2.0E-39
sp|P96166|NAGA_VIBFU N-acetylglucosamine-6-phosphate deacetylase OS=Vibrio furnissii GN=manD PE=3 SV=1 25 411 3.0E-39
sp|P44537|NAGA_HAEIN N-acetylglucosamine-6-phosphate deacetylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nagA PE=3 SV=1 59 425 9.0E-37
sp|A0KYQ5|AGAA2_SHESA N-acetylgalactosamine-6-phosphate deacetylase OS=Shewanella sp. (strain ANA-3) GN=agaAII PE=1 SV=1 36 432 8.0E-24
sp|P42906|AGAA_ECOLI Putative N-acetylgalactosamine-6-phosphate deacetylase OS=Escherichia coli (strain K12) GN=agaA PE=5 SV=3 251 427 1.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|491
MPIALSSPQPRPNGLTKFTNCRLAKGHELVHEDLWVSAATGTIIDSQATFYDDFNLPDETIDLGGRIVAPGMIDC
QLNGAFGFNFSTLLDDMSKYGKRVRDVNRQLIQTGVTSYMPTITSQRPELYQQALPYLGPSGAMRLADQGAESLG
AHCEGPFLSPTKNGVHNIDVLRQADTFADIEACYGAHNLSSRATDPTAPIKMLTAAPERGRMIHLISELTARGII
VSIGHSEATYEDASQAVGQGASMITHLFNAMRPLHHRNPGIFGVLGQAESLARPYFGIIADGIHLHPTTIKIAFN
AHPDGFILVTDAMHLVGLPDGAYPWTNGEQTCNIVKQGPRLLLENSDTIAGSSITLVECVNNFLQWTGAGIPQAL
RAVTATPAAMLGLGGVKGTLDAGADADLVVLSEDMSGDGCQQLVVDEVWKFGTRCYRR*
Coding >OphauB2|491
ATGCCCATCGCGCTCTCCTCCCCGCAACCTCGGCCCAACGGCCTTACCAAGTTCACGAATTGTCGCCTGGCCAAA
GGTCATGAGCTTGTCCACGAGGACCTCTGGGTCAGTGCCGCCACAGGAACAATCATTGACAGCCAAGCCACCTTT
TACGATGATTTCAATTTACCCGACGAGACTATCGATCTCGGCGGCCGCATCGTGGCGCCCGGCATGATCGACTGC
CAACTTAACGGCGCCTTTGGCTTCAACTTCTCAACTTTGCTCGATGACATGTCCAAATATGGAAAAAGAGTCCGT
GACGTCAACCGCCAGCTCATCCAGACGGGTGTCACGTCGTACATGCCCACAATCACAAGCCAGCGACCAGAACTA
TATCAACAAGCCCTTCCGTATCTGGGTCCTTCTGGGGCTATGCGGCTTGCAGACCAAGGGGCTGAGTCGCTGGGG
GCACACTGCGAAGGTCCCTTCCTGAGCCCTACCAAAAATGGTGTCCACAACATCGACGTGCTGCGCCAGGCCGAC
ACATTCGCCGACATAGAAGCCTGCTATGGTGCCCATAATCTCAGCTCTCGGGCAACGGACCCAACGGCGCCGATT
AAGATGCTGACAGCGGCACCGGAGCGGGGCCGGATGATACATCTGATATCCGAGCTGACGGCGCGGGGTATAATC
GTCTCCATCGGTCACTCGGAGGCCACGTACGAAGACGCGTCGCAGGCGGTAGGTCAAGGGGCGTCCATGATTACC
CACCTCTTTAATGCAATGCGGCCGTTACACCACCGCAATCCCGGCATCTTTGGCGTCTTGGGTCAGGCCGAAAGC
CTAGCGCGGCCCTACTTTGGCATAATTGCCGACGGCATCCACCTGCACCCGACTACAATCAAGATTGCCTTCAAC
GCACATCCCGATGGCTTCATTCTTGTCACTGATGCCATGCACCTAGTCGGTTTGCCTGACGGAGCCTACCCTTGG
ACCAACGGAGAGCAGACTTGTAATATTGTGAAGCAAGGCCCACGCCTGCTCCTCGAGAACTCGGATACAATAGCC
GGCAGCTCGATTACTCTTGTCGAGTGCGTCAACAACTTTTTGCAGTGGACGGGGGCCGGTATCCCACAGGCACTT
CGGGCGGTAACGGCTACGCCAGCAGCAATGCTAGGTCTTGGAGGAGTCAAGGGGACCCTGGACGCTGGCGCCGAT
GCCGACTTGGTGGTTCTTTCCGAAGACATGTCAGGCGATGGCTGCCAGCAGCTCGTTGTGGACGAAGTTTGGAAA
TTTGGTACACGTTGCTACCGGCGATGA
Transcript >OphauB2|491
ATGCCCATCGCGCTCTCCTCCCCGCAACCTCGGCCCAACGGCCTTACCAAGTTCACGAATTGTCGCCTGGCCAAA
GGTCATGAGCTTGTCCACGAGGACCTCTGGGTCAGTGCCGCCACAGGAACAATCATTGACAGCCAAGCCACCTTT
TACGATGATTTCAATTTACCCGACGAGACTATCGATCTCGGCGGCCGCATCGTGGCGCCCGGCATGATCGACTGC
CAACTTAACGGCGCCTTTGGCTTCAACTTCTCAACTTTGCTCGATGACATGTCCAAATATGGAAAAAGAGTCCGT
GACGTCAACCGCCAGCTCATCCAGACGGGTGTCACGTCGTACATGCCCACAATCACAAGCCAGCGACCAGAACTA
TATCAACAAGCCCTTCCGTATCTGGGTCCTTCTGGGGCTATGCGGCTTGCAGACCAAGGGGCTGAGTCGCTGGGG
GCACACTGCGAAGGTCCCTTCCTGAGCCCTACCAAAAATGGTGTCCACAACATCGACGTGCTGCGCCAGGCCGAC
ACATTCGCCGACATAGAAGCCTGCTATGGTGCCCATAATCTCAGCTCTCGGGCAACGGACCCAACGGCGCCGATT
AAGATGCTGACAGCGGCACCGGAGCGGGGCCGGATGATACATCTGATATCCGAGCTGACGGCGCGGGGTATAATC
GTCTCCATCGGTCACTCGGAGGCCACGTACGAAGACGCGTCGCAGGCGGTAGGTCAAGGGGCGTCCATGATTACC
CACCTCTTTAATGCAATGCGGCCGTTACACCACCGCAATCCCGGCATCTTTGGCGTCTTGGGTCAGGCCGAAAGC
CTAGCGCGGCCCTACTTTGGCATAATTGCCGACGGCATCCACCTGCACCCGACTACAATCAAGATTGCCTTCAAC
GCACATCCCGATGGCTTCATTCTTGTCACTGATGCCATGCACCTAGTCGGTTTGCCTGACGGAGCCTACCCTTGG
ACCAACGGAGAGCAGACTTGTAATATTGTGAAGCAAGGCCCACGCCTGCTCCTCGAGAACTCGGATACAATAGCC
GGCAGCTCGATTACTCTTGTCGAGTGCGTCAACAACTTTTTGCAGTGGACGGGGGCCGGTATCCCACAGGCACTT
CGGGCGGTAACGGCTACGCCAGCAGCAATGCTAGGTCTTGGAGGAGTCAAGGGGACCCTGGACGCTGGCGCCGAT
GCCGACTTGGTGGTTCTTTCCGAAGACATGTCAGGCGATGGCTGCCAGCAGCTCGTTGTGGACGAAGTTTGGAAA
TTTGGTACACGTTGCTACCGGCGATGA
Gene >OphauB2|491
ATGCCCATCGCGCTCTCCTCCCCGCAACCTCGGCCCAACGGCCTTACCAAGTTCACGAATTGTCGCCTGGCCAAA
GGTCATGAGCTTGTCCACGAGGACCTCTGGGTCAGTGCCGCCACAGGAACAATCATTGACAGCCAAGCCACCTTT
TACGATGATTTCAATTTACCCGACGAGACTATCGATCTCGGCGGCCGCATCGTGGCGCCCGGCATGATCGACTGC
CAACTTAACGGCGCCTTTGGCTTCAACTTCTCAACTTTGCTCGATGACATGTCCAAATATGGAAAAAGAGTCCGT
GACGTCAACCGCCAGCTCATCCAGACGGGTGTCACGTCGTACATGCCCACAATCACAAGCCAGCGACCAGAACTA
TATCAACAAGTACGTCCGAGGGCTGATGCAAGTACCGCGATAGCGGCCTGGCTTCCATGCAGTAAGCGAGCTGAT
GTCGTGACTGTTTTGTTTCCAGGCCCTTCCGTATCTGGGTCCTTCTGGGGCTATGCGGCTTGCAGACCAAGGGGC
TGAGTCGCTGGGGGCACACTGCGAAGGTCCCTTCCTGAGCCCTACCAAAAATGGTGTCCACAACATCGACGTGCT
GCGCCAGGCCGACACATTCGCCGACATAGAAGCCTGCTATGGTGCCCATAATCTCAGCTCTCGGGCAACGGACCC
AACGGCGCCGATTAAGATGCTGACAGCGGCACCGGAGCGGGGCCGGATGATACATCTGATATCCGAGCTGACGGC
GCGGGGTATAATCGTCTCCATCGGTCACTCGGAGGCCACGTACGAAGACGCGTCGCAGGCGGTAGGTCAAGGGGC
GTCCATGATTACCCACCTCTTTAATGCAATGCGGCCGTTACACCACCGCAATCCCGGCATCTTTGGCGTCTTGGG
TCAGGCCGAAAGCCTAGCGCGGCCCTACTTTGGCATAATTGCCGACGGCATCCACCTGCACCCGACTACAATCAA
GATTGCCTTCAACGCACATCCCGATGGCTTCATTCTTGTCACTGATGCCATGCACCTAGTCGGTTTGCCTGACGG
AGCCTACCCTTGGACCAACGGAGAGCAGACTTGTAATATTGTGAAGCAAGGCCCACGCCTGCTCCTCGAGAACTC
GGATACAATAGCCGGCAGGTAAGCCTGTGTCTGTTTGCTGTCAATACCGTCCAAACTGTCACCCGAGACGCCCCC
AGCCCCTAGTTCCGAGGCGGGCGGCCAACCTCCGGGCCCATGCATGTCATGGCATATCATGGCTGCGTTGCGTTG
CATGGGCACATGCTACGGATAAAGCTGTCGAAGCCATTGGTGCTGATGCAGCCGAGACTGACACGTCTTTTGCAG
CTCGATTACTCTTGTCGAGTGCGTCAACAACTTTTTGCAGTGGACGGGGGCCGGTATCCCACAGGCACTTCGGGC
GGTAACGGCTACGCCAGCAGCAATGCTAGGTCTTGGAGGAGTCAAGGGGACCCTGGACGCTGGCGCCGATGCCGA
CTTGGTGGTTCTTTCCGAAGACATGTCAGGCGATGGCTGCCAGCAGCTCGTTGTGGACGAAGTTTGGAAATTTGG
TACACGTTGCTACCGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail