Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4902
Gene name
LocationContig_35:23668..25264
Strand-
Gene length (bp)1596
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.3E-31 176 414

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36618|CDC16_SCHPO Cell division control protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc16 PE=1 SV=1 159 458 2.0E-79
sp|P26448|BUB2_YEAST Mitotic check point protein BUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB2 PE=1 SV=1 159 457 3.0E-64
sp|Q55EP9|BUB2_DICDI Putative mitotic check point protein BUB2 OS=Dictyostelium discoideum GN=bub2 PE=3 SV=1 168 459 3.0E-51
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 287 416 1.0E-08
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 287 416 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36618|CDC16_SCHPO Cell division control protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc16 PE=1 SV=1 159 458 2.0E-79
sp|P26448|BUB2_YEAST Mitotic check point protein BUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB2 PE=1 SV=1 159 457 3.0E-64
sp|Q55EP9|BUB2_DICDI Putative mitotic check point protein BUB2 OS=Dictyostelium discoideum GN=bub2 PE=3 SV=1 168 459 3.0E-51
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 287 416 1.0E-08
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 287 416 5.0E-08
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 207 447 1.0E-07
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 290 424 2.0E-07
sp|Q8BYH7|TBC17_MOUSE TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=1 SV=2 290 434 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4902
MPSSPSRGALSPSPSPPPSSPASSLAPMAEADPRPSSPSPRSYRALRRLQSAHALGATRTGNQPSLISQQRRHLY
RSTSPSGDYNPRPLSNRSPSRLRANSEATSPSLGHHNTALGYPITARRVTLKSPVFSHGHLSLQQIIRDGPNDDD
FQGALESARWKVVDQGIKSAEDGMSTLRIYVWLVLLDTPIMSTDEYLTLVHRGASPAYSKIRNDTFRTLTTDPLF
RRRVSEASLIRLLNAVAWKLHDAKEGQRQSRPSSQQSSHYRESLTGSVSGTSQAKSSVGPEPGTYVQGMNVLAAP
FLYAARSEGEAFVAFYSLLTRECPAYIRGAMDGVHRGLALVDKVLAIVDPKLSMYLTAKGLSAEIYAFPSVLTLC
ACTPPLPEVLRLWDFLFAYGPHLNILCIVAQLTIMRSQILQSPSPNKVLRSFPQLNADLVKSVTIGITKQIPDDV
YAEIVVHAL*
Coding >OphauB2|4902
ATGCCCTCGAGCCCGTCGCGAGGCGCGCTTTCGCCCTCTCCATCTCCACCACCTTCGTCGCCCGCCTCGTCACTT
GCCCCCATGGCTGAAGCCGACCCGCGACCTTCATCGCCCTCACCGCGCTCCTATCGCGCTCTCAGGCGGCTCCAA
TCCGCTCATGCCCTTGGAGCTACCCGTACTGGAAACCAACCTTCCCTGATATCCCAACAGCGGCGCCATCTTTAC
CGCTCAACTTCTCCTTCAGGCGACTACAATCCCCGCCCCCTGTCCAATCGCTCGCCTAGTCGCTTGCGAGCAAAT
AGCGAGGCCACATCGCCTTCTCTTGGCCATCACAACACGGCGCTCGGCTACCCAATCACAGCCAGACGCGTCACT
CTCAAAAGCCCCGTCTTCTCCCATGGTCACCTTTCCCTGCAGCAAATCATTCGCGATGGACCCAATGATGATGAC
TTTCAGGGCGCCCTTGAAAGCGCCAGGTGGAAGGTTGTAGACCAAGGCATCAAGAGTGCCGAAGATGGCATGTCT
ACCCTGAGGATCTACGTCTGGCTCGTACTTCTCGACACGCCAATCATGTCTACTGACGAATATCTCACTCTGGTG
CATCGGGGCGCCTCGCCCGCATACTCCAAGATTCGCAACGACACTTTTCGGACGCTCACTACCGACCCGCTGTTC
CGTAGGCGCGTCAGCGAGGCAAGTTTGATTCGTCTTCTCAATGCTGTTGCGTGGAAGCTTCATGATGCAAAAGAA
GGCCAGCGCCAAAGTCGTCCGAGTAGTCAACAGTCGTCTCATTATCGCGAGAGCCTCACTGGTAGTGTCTCTGGG
ACCTCTCAAGCAAAATCGTCTGTGGGCCCCGAGCCAGGCACCTATGTTCAAGGCATGAATGTTTTGGCAGCACCC
TTCCTCTATGCCGCTCGCAGCGAGGGCGAGGCCTTTGTTGCTTTTTACTCACTCTTGACCCGCGAGTGTCCTGCC
TATATACGCGGAGCCATGGATGGTGTGCATCGTGGCCTTGCTCTGGTTGACAAGGTCCTGGCCATTGTCGACCCC
AAGCTCAGCATGTACCTGACGGCCAAAGGCCTTTCGGCCGAGATTTACGCCTTTCCCTCCGTCTTGACTCTTTGT
GCATGCACGCCGCCATTGCCCGAGGTGCTTCGGCTGTGGGACTTTTTATTTGCCTACGGTCCCCATCTCAACATT
CTCTGCATCGTGGCTCAGCTCACCATAATGAGATCACAGATTCTTCAATCCCCTAGTCCTAATAAAGTCTTGCGA
TCCTTTCCGCAGCTAAACGCCGATCTTGTCAAGAGTGTAACAATTGGTATTACGAAACAGATACCTGACGATGTC
TACGCAGAGATTGTGGTGCATGCGCTATAA
Transcript >OphauB2|4902
ATGCCCTCGAGCCCGTCGCGAGGCGCGCTTTCGCCCTCTCCATCTCCACCACCTTCGTCGCCCGCCTCGTCACTT
GCCCCCATGGCTGAAGCCGACCCGCGACCTTCATCGCCCTCACCGCGCTCCTATCGCGCTCTCAGGCGGCTCCAA
TCCGCTCATGCCCTTGGAGCTACCCGTACTGGAAACCAACCTTCCCTGATATCCCAACAGCGGCGCCATCTTTAC
CGCTCAACTTCTCCTTCAGGCGACTACAATCCCCGCCCCCTGTCCAATCGCTCGCCTAGTCGCTTGCGAGCAAAT
AGCGAGGCCACATCGCCTTCTCTTGGCCATCACAACACGGCGCTCGGCTACCCAATCACAGCCAGACGCGTCACT
CTCAAAAGCCCCGTCTTCTCCCATGGTCACCTTTCCCTGCAGCAAATCATTCGCGATGGACCCAATGATGATGAC
TTTCAGGGCGCCCTTGAAAGCGCCAGGTGGAAGGTTGTAGACCAAGGCATCAAGAGTGCCGAAGATGGCATGTCT
ACCCTGAGGATCTACGTCTGGCTCGTACTTCTCGACACGCCAATCATGTCTACTGACGAATATCTCACTCTGGTG
CATCGGGGCGCCTCGCCCGCATACTCCAAGATTCGCAACGACACTTTTCGGACGCTCACTACCGACCCGCTGTTC
CGTAGGCGCGTCAGCGAGGCAAGTTTGATTCGTCTTCTCAATGCTGTTGCGTGGAAGCTTCATGATGCAAAAGAA
GGCCAGCGCCAAAGTCGTCCGAGTAGTCAACAGTCGTCTCATTATCGCGAGAGCCTCACTGGTAGTGTCTCTGGG
ACCTCTCAAGCAAAATCGTCTGTGGGCCCCGAGCCAGGCACCTATGTTCAAGGCATGAATGTTTTGGCAGCACCC
TTCCTCTATGCCGCTCGCAGCGAGGGCGAGGCCTTTGTTGCTTTTTACTCACTCTTGACCCGCGAGTGTCCTGCC
TATATACGCGGAGCCATGGATGGTGTGCATCGTGGCCTTGCTCTGGTTGACAAGGTCCTGGCCATTGTCGACCCC
AAGCTCAGCATGTACCTGACGGCCAAAGGCCTTTCGGCCGAGATTTACGCCTTTCCCTCCGTCTTGACTCTTTGT
GCATGCACGCCGCCATTGCCCGAGGTGCTTCGGCTGTGGGACTTTTTATTTGCCTACGGTCCCCATCTCAACATT
CTCTGCATCGTGGCTCAGCTCACCATAATGAGATCACAGATTCTTCAATCCCCTAGTCCTAATAAAGTCTTGCGA
TCCTTTCCGCAGCTAAACGCCGATCTTGTCAAGAGTGTAACAATTGGTATTACGAAACAGATACCTGACGATGTC
TACGCAGAGATTGTGGTGCATGCGCTATAA
Gene >OphauB2|4902
ATGCCCTCGAGCCCGTCGCGAGGCGCGCTTTCGCCCTCTCCATCTCCACCACCTTCGTCGCCCGCCTCGTCACTT
GCCCCCATGGCTGAAGCCGACCCGCGACCTTCATCGCCCTCACCGCGCTCCTATCGCGCTCTCAGGCGGCTCCAA
TCCGCTCATGCCCTTGGAGCTACCCGTACTGGAAACCAACCTTCCCTGATATCCCAACAGCGGCGCCATCTTTAC
CGCTCAACTTCTCCTTCAGGCGACTACAATCCCCGCCCCCTGTCCAATCGCTCGCCTAGTCGCTTGCGAGCAAAT
AGCGAGGCCACATCGCCTTCTCTTGGCCATCACAACACGGCGCTCGGCTACCCAATCACAGCCAGACGCGTCACT
CTCAAAAGCCCCGTCTTCTCCCATGGTCACCTTTCCCTGCAGCAAATCATTCGCGATGGACCCAATGATGATGAC
TTTCAGGGCGCCCTTGAAAGCGCCAGGTGGAAGGTTGTAGACCAAGGCATCAAGAGTGCCGAAGATGGCATGGTA
GGCCTACCAACTATTCCTCTCGTAAGCGCCTCGAGTTGACGCTTCGTGTTTGCTTGCCACAGTCTACCCTGAGGA
TCTACGTCTGGCTCGTACTTCTCGACACGCCAATCATGTCTACTGACGAATATCTCACTCTGGTGCATCGGGGCG
CCTCGCCCGCATACTCCAAGATTCGCAACGACACTTTTCGGACGCTCACTACCGACCCGCTGTTCCGTAGGCGCG
TCAGCGAGGCAAGTTTGATTCGTCTTCTCAATGCTGTTGCGTGGAAGCTTCATGATGCAAAAGAAGGCCAGCGCC
AAAGTCGTCCGAGTAGTCAACAGTCGTCTCATTATCGCGAGAGCCTCACTGGTAGTGTCTCTGGGACCTCTCAAG
CAAGTACGTCGCCTCAATCGCTCTCATGTTTGTCATGACTTGCTCCTTGCTAATTCTTGCCTTTAGAATCGTCTG
TGGGCCCCGAGCCAGGCACCTATGTTCAAGGCATGAATGTTTTGGCAGCACCCTTCCTCTATGCCGCTCGCAGCG
AGGGCGAGGCCTTTGTTGCTTTTTACTCACTCTTGACCCGCGAGTGTCCTGCCTATATACGCGGAGCCATGGATG
GTGTGCATCGTGGCCTTGCTCTGGTTGACAAGGTCCTGGCCATTGTCGACCCCAAGCTCAGCATGTACCTGACGG
CCAAAGGCCTTTCGGCCGAGATTTACGCCTTTCCCTCCGTCTTGACTCTTTGTGCATGCACGCCGCCATTGCCCG
AGGTGCTTCGGCTGTGGGACTTTTTATTTGCCTACGGTCCCCATCTCAACATTCTCTGCATCGTGGCTCAGCTCA
CCATAATGAGATCACAGATTCTTCAATCCCCTAGGTCAGGATACCCGGTCTAGAGTCCTTTTCCACGGATATACG
CCACTTGCACGTCGACTACCATCAACCAATCGCTGACTTGTTTCTAGTCCTAATAAAGTCTTGCGATCCTTTCCG
CAGCTAAACGCCGATCTTGTCAAGAGTGTAACAATTGGTATTACGAAACAGATACCTGACGATGTCTACGCAGAG
ATTGTGGTGCATGCGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail