Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4901
Gene name
LocationContig_35:21439..22987
Strand+
Gene length (bp)1548
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03006 HlyIII Haemolysin-III related 4.8E-58 272 494

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.11 PE=4 SV=1 31 500 8.0E-72
sp|Q07959|IZH3_YEAST ADIPOR-like receptor IZH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH3 PE=1 SV=1 165 466 9.0E-39
sp|Q94177|ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans GN=paqr-1 PE=3 SV=2 126 514 1.0E-34
sp|Q75F81|IZH3_ASHGO ADIPOR-like receptor IZH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH3 PE=3 SV=1 237 500 2.0E-31
sp|Q9VCY8|ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster GN=AdipoR PE=1 SV=2 215 499 4.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.11 PE=4 SV=1 31 500 8.0E-72
sp|Q07959|IZH3_YEAST ADIPOR-like receptor IZH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH3 PE=1 SV=1 165 466 9.0E-39
sp|Q94177|ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans GN=paqr-1 PE=3 SV=2 126 514 1.0E-34
sp|Q75F81|IZH3_ASHGO ADIPOR-like receptor IZH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH3 PE=3 SV=1 237 500 2.0E-31
sp|Q9VCY8|ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster GN=AdipoR PE=1 SV=2 215 499 4.0E-31
sp|Q86V24|ADR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens GN=ADIPOR2 PE=1 SV=1 215 512 2.0E-29
sp|Q8BQS5|ADR2_MOUSE Adiponectin receptor protein 2 OS=Mus musculus GN=Adipor2 PE=1 SV=2 215 512 2.0E-29
sp|Q91VH1|ADR1_MOUSE Adiponectin receptor protein 1 OS=Mus musculus GN=Adipor1 PE=1 SV=1 215 512 8.0E-29
sp|Q96A54|ADR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapiens GN=ADIPOR1 PE=1 SV=1 215 512 1.0E-28
sp|Q03419|IZH1_YEAST ADIPOR-like receptor IZH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH1 PE=1 SV=1 200 497 1.0E-26
sp|Q6TCG8|PAQR3_MOUSE Progestin and adipoQ receptor family member 3 OS=Mus musculus GN=Paqr3 PE=2 SV=1 230 515 6.0E-26
sp|Q6TCH7|PAQR3_HUMAN Progestin and adipoQ receptor family member 3 OS=Homo sapiens GN=PAQR3 PE=1 SV=2 230 515 1.0E-25
sp|Q9ZUH8|HHP3_ARATH Heptahelical transmembrane protein 3 OS=Arabidopsis thaliana GN=HHP3 PE=2 SV=2 194 512 3.0E-25
sp|Q753H5|IZH1_ASHGO ADIPOR-like receptor IZH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH1 PE=3 SV=1 201 497 3.0E-24
sp|Q09749|ADRL_SCHPO ADIPOR-like receptor SPBC12C2.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.09c PE=3 SV=1 234 497 2.0E-23
sp|Q84N34|HHP2_ARATH Heptahelical transmembrane protein 2 OS=Arabidopsis thaliana GN=HHP2 PE=2 SV=1 235 512 1.0E-21
sp|Q93ZH9|HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana GN=HHP1 PE=1 SV=1 209 500 2.0E-20
sp|A8WZU4|ADRL_CAEBR Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis briggsae GN=paqr-1 PE=3 SV=2 191 514 5.0E-19
sp|Q9SVF3|HPP5_ARATH Heptahelical transmembrane protein 5 OS=Arabidopsis thaliana GN=HHP5 PE=2 SV=1 351 496 7.0E-19
sp|Q9SZG0|HHP4_ARATH Heptahelical transmembrane protein 4 OS=Arabidopsis thaliana GN=HHP4 PE=2 SV=1 351 496 2.0E-18
sp|Q12442|IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH2 PE=1 SV=2 201 511 4.0E-18
sp|Q6ETK9|ADPO2_ORYSJ Heptahelical transmembrane protein ADIPOR2 OS=Oryza sativa subsp. japonica GN=ADIPOR2 PE=2 SV=1 318 498 2.0E-17
sp|B7F9G7|ADPO1_ORYSJ Heptahelical transmembrane protein ADIPOR1 OS=Oryza sativa subsp. japonica GN=ADIPOR1 PE=2 SV=1 237 513 6.0E-17
sp|Q10PI5|ADPO3_ORYSJ Heptahelical transmembrane protein ADIPOR3 OS=Oryza sativa subsp. japonica GN=ADIPOR3 PE=2 SV=1 351 496 2.0E-16
sp|Q9JJE4|PAQR4_MOUSE Progestin and adipoQ receptor family member 4 OS=Mus musculus GN=Paqr4 PE=2 SV=1 237 513 3.0E-08
sp|Q8N4S7|PAQR4_HUMAN Progestin and adipoQ receptor family member 4 OS=Homo sapiens GN=PAQR4 PE=2 SV=3 237 513 5.0E-08
sp|Q9NXK6|MPRG_HUMAN Membrane progestin receptor gamma OS=Homo sapiens GN=PAQR5 PE=1 SV=2 237 487 1.0E-07
sp|Q9DCU0|MPRG_MOUSE Membrane progestin receptor gamma OS=Mus musculus GN=Paqr5 PE=2 SV=1 237 487 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 281 300 19
2 313 335 22
3 345 367 22
4 380 399 19
5 409 431 22
6 438 460 22
7 470 492 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4901
MTNVTTTLTSTCSRARAGDDGEIGRVAQAASGSQVHCTSSDHGPRRRHSFFLPRRKSIAETLMDGEDGLLLKVDL
FLSELERRLDFIENYGDLGRDYSFSRAFSTLQAVRSRCSHASEEMIGAGRRRLHVMVETLEARYQETLAATESLH
EKACVGIDLLEGMLSEFEASAHKLRDQGLANAATAAEVFMGEGRRVANESIERARGVVDEGLECARRAALSLEEH
IQQAVVLARERRLLLYDDLPMPWRNNPHIKKGYRFTESKLECVRSMFNISNESFNIWSHAVGLVLVLAVALYFYP
TSANFGLSSKSDVFVAAVFFVMAGLTLVCSTVWHTMNAVADVNAISIFACVDYTGISLLIAASILTTEYTAFYCD
PVSRYVYMTLTALLGLGGVVLPWHPRFNGADMAWARVAFYVGLALTGSMPVLQLYLTHGPDFVCNFYLPLTKSIL
VYFGGAIVYASKIPERWFPGVFDYIGGSHNLWHAAVLGGILFHYKAMQQFFASAFHRAEGGCPLY*
Coding >OphauB2|4901
ATGACAAACGTCACAACGACACTCACGTCGACTTGCAGTCGAGCGCGTGCCGGTGACGATGGCGAAATCGGCCGT
GTCGCACAGGCGGCCTCGGGTTCCCAAGTGCACTGCACCTCGTCAGACCACGGCCCGCGCCGCCGACATTCCTTC
TTCCTGCCCCGCCGCAAGTCCATTGCCGAGACTCTGATGGATGGCGAAGACGGGCTGCTGCTCAAGGTGGACCTT
TTTCTCTCAGAACTTGAGCGGCGCCTCGACTTTATCGAAAACTATGGCGACTTGGGCAGAGACTATAGTTTCTCG
CGCGCCTTTTCCACTCTGCAGGCCGTGCGCTCACGATGCTCTCACGCCTCGGAGGAGATGATTGGCGCCGGCCGC
CGAAGACTGCACGTCATGGTTGAAACGCTCGAGGCGCGATACCAAGAGACGCTGGCTGCCACGGAGTCGCTGCAT
GAAAAGGCTTGCGTCGGCATCGACCTCCTCGAGGGCATGCTGTCGGAATTCGAGGCCAGCGCGCACAAGCTGCGT
GATCAGGGCCTTGCCAACGCCGCCACCGCCGCAGAGGTGTTTATGGGCGAGGGCCGCCGCGTCGCCAATGAAAGC
ATTGAACGGGCTCGAGGAGTCGTGGATGAAGGCCTCGAGTGCGCCCGCCGTGCCGCCCTCTCGCTCGAGGAGCAT
ATCCAACAGGCCGTCGTGCTGGCCCGTGAGCGGCGCCTGCTCCTCTATGATGACTTGCCCATGCCCTGGCGCAAC
AACCCGCACATCAAAAAGGGCTATCGCTTCACCGAGTCCAAGCTCGAGTGCGTGCGCTCCATGTTCAACATCTCC
AACGAGTCGTTCAACATTTGGTCCCATGCCGTTGGCCTCGTCCTCGTCCTTGCCGTGGCGCTCTACTTTTACCCA
ACCAGCGCCAACTTTGGCCTCAGCAGCAAGAGTGACGTCTTTGTCGCCGCCGTCTTCTTCGTCATGGCTGGCCTG
ACTCTAGTCTGCTCGACTGTCTGGCACACCATGAATGCCGTTGCCGACGTGAATGCCATTTCCATTTTTGCATGT
GTCGATTACACCGGCATCTCACTCCTCATTGCCGCCTCGATCCTGACGACTGAGTACACCGCCTTTTACTGTGAC
CCCGTCAGCCGCTACGTCTACATGACGCTGACGGCCTTGCTTGGTCTTGGCGGCGTCGTCTTGCCTTGGCACCCG
CGCTTCAACGGCGCCGACATGGCCTGGGCAAGAGTCGCCTTTTACGTTGGCCTGGCCCTTACGGGATCCATGCCC
GTCTTGCAGCTCTATCTGACACACGGGCCCGACTTTGTCTGCAACTTTTACCTGCCCCTGACAAAGTCCATCTTG
GTCTACTTTGGCGGCGCCATTGTCTACGCCAGCAAGATTCCAGAGCGCTGGTTCCCGGGCGTATTTGACTATATT
GGCGGCAGCCACAATCTCTGGCACGCCGCCGTCCTTGGCGGCATCCTCTTTCACTACAAGGCCATGCAGCAGTTT
TTTGCCAGTGCCTTTCACCGTGCAGAGGGCGGTTGTCCACTCTACTGA
Transcript >OphauB2|4901
ATGACAAACGTCACAACGACACTCACGTCGACTTGCAGTCGAGCGCGTGCCGGTGACGATGGCGAAATCGGCCGT
GTCGCACAGGCGGCCTCGGGTTCCCAAGTGCACTGCACCTCGTCAGACCACGGCCCGCGCCGCCGACATTCCTTC
TTCCTGCCCCGCCGCAAGTCCATTGCCGAGACTCTGATGGATGGCGAAGACGGGCTGCTGCTCAAGGTGGACCTT
TTTCTCTCAGAACTTGAGCGGCGCCTCGACTTTATCGAAAACTATGGCGACTTGGGCAGAGACTATAGTTTCTCG
CGCGCCTTTTCCACTCTGCAGGCCGTGCGCTCACGATGCTCTCACGCCTCGGAGGAGATGATTGGCGCCGGCCGC
CGAAGACTGCACGTCATGGTTGAAACGCTCGAGGCGCGATACCAAGAGACGCTGGCTGCCACGGAGTCGCTGCAT
GAAAAGGCTTGCGTCGGCATCGACCTCCTCGAGGGCATGCTGTCGGAATTCGAGGCCAGCGCGCACAAGCTGCGT
GATCAGGGCCTTGCCAACGCCGCCACCGCCGCAGAGGTGTTTATGGGCGAGGGCCGCCGCGTCGCCAATGAAAGC
ATTGAACGGGCTCGAGGAGTCGTGGATGAAGGCCTCGAGTGCGCCCGCCGTGCCGCCCTCTCGCTCGAGGAGCAT
ATCCAACAGGCCGTCGTGCTGGCCCGTGAGCGGCGCCTGCTCCTCTATGATGACTTGCCCATGCCCTGGCGCAAC
AACCCGCACATCAAAAAGGGCTATCGCTTCACCGAGTCCAAGCTCGAGTGCGTGCGCTCCATGTTCAACATCTCC
AACGAGTCGTTCAACATTTGGTCCCATGCCGTTGGCCTCGTCCTCGTCCTTGCCGTGGCGCTCTACTTTTACCCA
ACCAGCGCCAACTTTGGCCTCAGCAGCAAGAGTGACGTCTTTGTCGCCGCCGTCTTCTTCGTCATGGCTGGCCTG
ACTCTAGTCTGCTCGACTGTCTGGCACACCATGAATGCCGTTGCCGACGTGAATGCCATTTCCATTTTTGCATGT
GTCGATTACACCGGCATCTCACTCCTCATTGCCGCCTCGATCCTGACGACTGAGTACACCGCCTTTTACTGTGAC
CCCGTCAGCCGCTACGTCTACATGACGCTGACGGCCTTGCTTGGTCTTGGCGGCGTCGTCTTGCCTTGGCACCCG
CGCTTCAACGGCGCCGACATGGCCTGGGCAAGAGTCGCCTTTTACGTTGGCCTGGCCCTTACGGGATCCATGCCC
GTCTTGCAGCTCTATCTGACACACGGGCCCGACTTTGTCTGCAACTTTTACCTGCCCCTGACAAAGTCCATCTTG
GTCTACTTTGGCGGCGCCATTGTCTACGCCAGCAAGATTCCAGAGCGCTGGTTCCCGGGCGTATTTGACTATATT
GGCGGCAGCCACAATCTCTGGCACGCCGCCGTCCTTGGCGGCATCCTCTTTCACTACAAGGCCATGCAGCAGTTT
TTTGCCAGTGCCTTTCACCGTGCAGAGGGCGGTTGTCCACTCTACTGA
Gene >OphauB2|4901
ATGACAAACGTCACAACGACACTCACGTCGACTTGCAGTCGAGCGCGTGCCGGTGACGATGGCGAAATCGGCCGT
GTCGCACAGGCGGCCTCGGGTTCCCAAGTGCACTGCACCTCGTCAGACCACGGCCCGCGCCGCCGACATTCCTTC
TTCCTGCCCCGCCGCAAGTCCATTGCCGAGACTCTGATGGATGGCGAAGACGGGCTGCTGCTCAAGGTGGACCTT
TTTCTCTCAGAACTTGAGCGGCGCCTCGACTTTATCGAAAACTATGGCGACTTGGGCAGAGACTATAGTTTCTCG
CGCGCCTTTTCCACTCTGCAGGCCGTGCGCTCACGATGCTCTCACGCCTCGGAGGAGATGATTGGCGCCGGCCGC
CGAAGACTGCACGTCATGGTTGAAACGCTCGAGGCGCGATACCAAGAGACGCTGGCTGCCACGGAGTCGCTGCAT
GAAAAGGCTTGCGTCGGCATCGACCTCCTCGAGGGCATGCTGTCGGAATTCGAGGCCAGCGCGCACAAGCTGCGT
GATCAGGGCCTTGCCAACGCCGCCACCGCCGCAGAGGTGTTTATGGGCGAGGGCCGCCGCGTCGCCAATGAAAGC
ATTGAACGGGCTCGAGGAGTCGTGGATGAAGGCCTCGAGTGCGCCCGCCGTGCCGCCCTCTCGCTCGAGGAGCAT
ATCCAACAGGCCGTCGTGCTGGCCCGTGAGCGGCGCCTGCTCCTCTATGATGACTTGCCCATGCCCTGGCGCAAC
AACCCGCACATCAAAAAGGGCTATCGCTTCACCGAGTCCAAGCTCGAGTGCGTGCGCTCCATGTTCAACATCTCC
AACGAGTCGTTCAACATTTGGTCCCATGCCGTTGGCCTCGTCCTCGTCCTTGCCGTGGCGCTCTACTTTTACCCA
ACCAGCGCCAACTTTGGCCTCAGCAGCAAGAGTGACGTCTTTGTCGCCGCCGTCTTCTTCGTCATGGCTGGCCTG
ACTCTAGTCTGCTCGACTGTCTGGCACACCATGAATGCCGTTGCCGACGTGAATGCCATTTCCATTTTTGCATGT
GTCGATTACACCGGCATCTCACTCCTCATTGCCGCCTCGATCCTGACGACTGAGTACACCGCCTTTTACTGTGAC
CCCGTCAGCCGCTACGTCTACATGACGCTGACGGCCTTGCTTGGTCTTGGCGGCGTCGTCTTGCCTTGGCACCCG
CGCTTCAACGGCGCCGACATGGCCTGGGCAAGAGTCGCCTTTTACGTTGGCCTGGCCCTTACGGGATCCATGCCC
GTCTTGCAGCTCTATCTGACACACGGGCCCGACTTTGTCTGCAACTTTTACCTGCCCCTGACAAAGTCCATCTTG
GTCTACTTTGGCGGCGCCATTGTCTACGCCAGCAAGATTCCAGAGCGCTGGTTCCCGGGCGTATTTGACTATATT
GGCGGCAGCCACAATCTCTGGCACGCCGCCGTCCTTGGCGGCATCCTCTTTCACTACAAGGCCATGCAGCAGTTT
TTTGCCAGTGCCTTTCACCGTGCAGAGGGCGGTTGTCCACTCTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail