Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4893
Gene name
LocationContig_349:2755..3552
Strand+
Gene length (bp)797
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.1E-42 4 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 1 209 1.0E-33
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 1 209 2.0E-32
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 1 209 1.0E-31
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 1 209 2.0E-31
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 1 209 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 1 209 1.0E-33
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 1 209 2.0E-32
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 1 209 1.0E-31
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 1 209 2.0E-31
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 1 209 3.0E-31
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 1 209 2.0E-30
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 5 209 1.0E-29
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 2 209 1.0E-29
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 1 206 1.0E-28
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 2 206 3.0E-28
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 2 209 3.0E-28
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 1 210 5.0E-28
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 7 199 5.0E-28
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 6 206 6.0E-28
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 2 209 1.0E-27
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 2 195 3.0E-27
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 5 209 3.0E-27
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 6 196 4.0E-27
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 2 209 7.0E-27
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 5 218 1.0E-26
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 2 212 1.0E-26
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 6 204 2.0E-26
sp|Q16678|CP1B1_HUMAN Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 12 211 2.0E-26
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 2 195 2.0E-26
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 2 195 3.0E-26
sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 6 204 4.0E-26
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 6 209 5.0E-26
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 5 221 5.0E-26
sp|B9WZX4|FTME_ASPFM Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 5 221 5.0E-26
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 1 220 5.0E-26
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 5 222 5.0E-26
sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 2 195 6.0E-26
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 2 209 6.0E-26
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 5 211 1.0E-25
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 1 207 1.0E-25
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 6 204 1.0E-25
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 6 209 1.0E-25
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 6 204 1.0E-25
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 6 204 1.0E-25
sp|P00186|CP1A2_MOUSE Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1 9 195 2.0E-25
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 4 178 2.0E-25
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 4 178 2.0E-25
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 6 209 2.0E-25
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 6 188 2.0E-25
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 9 209 3.0E-25
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 3 201 4.0E-25
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 2 212 4.0E-25
sp|Q6WNQ9|C81E9_MEDTR Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 2 207 4.0E-25
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 2 212 4.0E-25
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 9 209 5.0E-25
sp|P04799|CP1A2_RAT Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 9 197 6.0E-25
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 1 209 6.0E-25
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 6 204 6.0E-25
sp|P79760|CP1A4_CHICK Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 6 195 6.0E-25
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 1 207 6.0E-25
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 5 209 6.0E-25
sp|P24453|CP1A2_MESAU Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 2 195 7.0E-25
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 2 195 7.0E-25
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 6 181 7.0E-25
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 2 212 7.0E-25
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 2 212 7.0E-25
sp|Q29497|CP17A_SHEEP Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 9 209 7.0E-25
sp|P98181|CP1A1_PAGMA Cytochrome P450 1A1 OS=Pagrus major GN=cyp1a1 PE=2 SV=1 2 195 8.0E-25
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 6 188 9.0E-25
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 4 210 9.0E-25
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 2 212 1.0E-24
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 5 209 1.0E-24
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 1 201 1.0E-24
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 5 209 1.0E-24
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 9 209 1.0E-24
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 9 209 1.0E-24
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 2 209 1.0E-24
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 6 209 1.0E-24
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 6 195 2.0E-24
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 3 201 2.0E-24
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 6 201 2.0E-24
sp|P79716|CP1A1_DICLA Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 2 195 2.0E-24
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 3 201 2.0E-24
sp|Q64678|CP1B1_RAT Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 12 211 2.0E-24
sp|P56657|CP240_MOUSE Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 2 201 2.0E-24
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 6 204 2.0E-24
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 6 209 3.0E-24
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 5 209 3.0E-24
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 6 209 3.0E-24
sp|Q1ZXL7|C5083_DICDI Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 6 209 3.0E-24
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 4 201 3.0E-24
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 6 204 4.0E-24
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 9 209 4.0E-24
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 6 181 4.0E-24
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 6 195 4.0E-24
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 2 209 4.0E-24
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 2 195 5.0E-24
sp|Q92110|CP1A1_ONCMY Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 2 195 5.0E-24
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 9 209 5.0E-24
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 1 204 5.0E-24
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 6 188 5.0E-24
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 6 209 6.0E-24
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 1 201 6.0E-24
sp|Q1ZXA4|C508D_DICDI Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 6 209 7.0E-24
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 6 201 7.0E-24
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 7 201 7.0E-24
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 1 201 7.0E-24
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 12 218 7.0E-24
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 6 201 7.0E-24
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 5 209 8.0E-24
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 6 201 1.0E-23
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 2 207 1.0E-23
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 6 202 1.0E-23
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 9 209 2.0E-23
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 5 209 2.0E-23
sp|Q6JZS3|CP1A1_ORYLA Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 2 210 2.0E-23
sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 1 201 2.0E-23
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 6 201 2.0E-23
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 6 207 2.0E-23
sp|B1NF20|C719E_ARGME Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 10 176 3.0E-23
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 6 209 3.0E-23
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 9 209 3.0E-23
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 9 209 3.0E-23
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 9 209 3.0E-23
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 3 201 3.0E-23
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 2 209 3.0E-23
sp|B1NF18|C719B_PAPSO Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 10 209 4.0E-23
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 2 208 4.0E-23
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 9 207 5.0E-23
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 6 207 5.0E-23
sp|Q29478|CP2CV_CAPHE Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 9 192 5.0E-23
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 9 204 5.0E-23
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 6 209 6.0E-23
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 9 209 7.0E-23
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 6 195 8.0E-23
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 2 209 9.0E-23
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 6 209 9.0E-23
sp|Q54SK0|C508B_DICDI Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 6 209 9.0E-23
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 6 194 1.0E-22
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 6 204 1.0E-22
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 12 207 1.0E-22
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 6 207 1.0E-22
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 3 209 2.0E-22
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 2 201 2.0E-22
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 9 209 2.0E-22
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 9 209 2.0E-22
sp|P19100|CP17A_PIG Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 1 209 3.0E-22
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 6 195 3.0E-22
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 6 202 3.0E-22
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 9 209 3.0E-22
sp|P11372|CP2CF_RABIT Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cuniculus GN=CYP2C15 PE=2 SV=1 28 201 3.0E-22
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 9 209 3.0E-22
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 6 207 3.0E-22
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 6 207 3.0E-22
sp|P12791|CP2BA_MOUSE Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 1 209 4.0E-22
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 6 212 4.0E-22
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 9 195 6.0E-22
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 6 209 7.0E-22
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 5 206 7.0E-22
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 6 204 7.0E-22
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 1 179 7.0E-22
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 6 204 7.0E-22
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 6 194 8.0E-22
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 6 200 8.0E-22
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 10 176 1.0E-21
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 3 201 1.0E-21
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 1 201 1.0E-21
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 2 188 1.0E-21
sp|Q9DBX6|CP2S1_MOUSE Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 1 208 1.0E-21
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 2 208 1.0E-21
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 9 179 2.0E-21
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 6 187 2.0E-21
sp|Q556M4|C5082_DICDI Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 3 209 2.0E-21
sp|Q95328|CP17A_HORSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 9 209 2.0E-21
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 2 197 3.0E-21
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 5 190 3.0E-21
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 6 185 5.0E-21
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 9 209 5.0E-21
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 6 179 5.0E-21
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 9 193 5.0E-21
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 6 195 7.0E-21
sp|P05178|CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 1 201 9.0E-21
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 6 203 1.0E-20
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 6 176 1.0E-20
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 1 188 1.0E-20
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 6 177 1.0E-20
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 10 210 1.0E-20
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 6 194 1.0E-20
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 6 202 1.0E-20
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 6 196 1.0E-20
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 6 207 1.0E-20
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 1 176 2.0E-20
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 6 185 2.0E-20
sp|Q9FLC8|C79A2_ARATH Phenylalanine N-monooxygenase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1 3 190 2.0E-20
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 6 188 2.0E-20
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 6 183 2.0E-20
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 9 181 2.0E-20
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 2 193 2.0E-20
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 6 201 2.0E-20
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 1 176 2.0E-20
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 5 209 2.0E-20
sp|Q9D816|CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 3 204 2.0E-20
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 1 188 2.0E-20
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 3 204 2.0E-20
sp|P13107|CP2B3_RAT Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 6 200 2.0E-20
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 5 193 3.0E-20
sp|P11510|CP2CC_RAT Cytochrome P450 2C12, female-specific OS=Rattus norvegicus GN=Cyp2c12 PE=2 SV=1 1 181 3.0E-20
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 9 193 3.0E-20
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 9 193 3.0E-20
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 3 177 3.0E-20
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 2 195 3.0E-20
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 9 196 3.0E-20
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 1 204 3.0E-20
sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 2 206 4.0E-20
sp|Q9M7B7|C79D2_MANES Valine N-monooxygenase 2 OS=Manihot esculenta GN=CYP79D2 PE=1 SV=1 4 200 4.0E-20
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 1 204 4.0E-20
sp|Q64583|CP2BF_RAT Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 28 209 4.0E-20
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 1 185 5.0E-20
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 9 163 5.0E-20
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 1 204 6.0E-20
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 7 176 7.0E-20
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 6 201 9.0E-20
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 6 192 9.0E-20
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 6 203 9.0E-20
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 10 209 1.0E-19
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 6 195 1.0E-19
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 6 189 1.0E-19
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 6 201 1.0E-19
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 9 210 1.0E-19
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 1 185 2.0E-19
sp|P92994|TCMO_ARATH Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 8 193 2.0E-19
sp|P24454|CP2A8_MESAU Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 1 188 2.0E-19
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 2 193 2.0E-19
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 10 210 2.0E-19
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 6 209 2.0E-19
sp|Q92090|CP2K1_ONCMY Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 6 195 2.0E-19
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 6 195 2.0E-19
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 6 210 3.0E-19
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 9 204 3.0E-19
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 6 195 3.0E-19
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 8 193 3.0E-19
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 1 211 4.0E-19
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 6 188 4.0E-19
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 1 176 4.0E-19
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 9 192 4.0E-19
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 6 207 4.0E-19
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 1 185 5.0E-19
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 2 184 6.0E-19
sp|P24470|CP2CN_RAT Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 24 209 6.0E-19
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 1 185 7.0E-19
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 6 176 7.0E-19
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 1 185 7.0E-19
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 6 209 8.0E-19
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 6 209 8.0E-19
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 1 185 8.0E-19
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 6 196 1.0E-18
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 1 209 1.0E-18
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 1 212 1.0E-18
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 5 176 1.0E-18
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 8 193 1.0E-18
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 1 191 2.0E-18
sp|P37115|TCMO_VIGRR Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 2 193 2.0E-18
sp|Q1ZXA1|C521A_DICDI Probable cytochrome P450 521A1 OS=Dictyostelium discoideum GN=cyp521A1 PE=3 SV=1 2 209 2.0E-18
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 1 185 2.0E-18
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 6 209 2.0E-18
sp|Q54E98|C520B_DICDI Putative cytochrome P450 520B1 OS=Dictyostelium discoideum GN=cyp520B1 PE=5 SV=1 6 209 2.0E-18
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 1 209 2.0E-18
sp|Q9Y7G5|PHACA_EMEND Phenylacetate 2-hydroxylase OS=Emericella nidulans GN=phacA PE=1 SV=1 31 215 3.0E-18
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 6 177 3.0E-18
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 6 210 3.0E-18
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 2 176 3.0E-18
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 2 176 3.0E-18
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 8 184 3.0E-18
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 6 176 3.0E-18
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 6 176 3.0E-18
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 6 209 3.0E-18
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 1 185 4.0E-18
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 1 185 4.0E-18
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 8 193 4.0E-18
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 6 176 5.0E-18
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 5 195 5.0E-18
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 6 210 5.0E-18
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 6 184 5.0E-18
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 3 180 5.0E-18
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 6 209 5.0E-18
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 6 183 6.0E-18
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 6 213 6.0E-18
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 6 209 7.0E-18
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 6 216 7.0E-18
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 6 201 7.0E-18
sp|Q54Q53|C519B_DICDI Probable cytochrome P450 519B1 OS=Dictyostelium discoideum GN=cyp519B1 PE=3 SV=1 1 209 7.0E-18
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 6 195 9.0E-18
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 6 202 1.0E-17
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 6 204 1.0E-17
sp|C0SPF7|C15C1_BOMMO Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 6 195 1.0E-17
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 8 176 1.0E-17
sp|Q9M7B8|C79D1_MANES Valine N-monooxygenase 1 OS=Manihot esculenta GN=CYP79D1 PE=1 SV=1 6 177 2.0E-17
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 6 184 2.0E-17
sp|Q43033|TCMO_PETCR Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 8 193 2.0E-17
sp|P58047|C71AS_ARATH Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2 18 177 2.0E-17
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 6 204 2.0E-17
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 1 199 2.0E-17
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 6 176 3.0E-17
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 6 206 3.0E-17
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 6 209 3.0E-17
sp|O24312|TCMO_POPTM Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 8 193 3.0E-17
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 6 214 3.0E-17
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 1 209 3.0E-17
sp|Q43054|TCMO_POPKI Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 8 193 3.0E-17
sp|P12939|CP2DA_RAT Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 28 212 4.0E-17
sp|Q54QD0|C5174_DICDI Probable cytochrome P450 517A4 OS=Dictyostelium discoideum GN=cyp517A4 PE=3 SV=1 10 210 4.0E-17
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 6 209 4.0E-17
sp|Q54QD2|C5171_DICDI Probable cytochrome P450 517A1 OS=Dictyostelium discoideum GN=cyp517A1 PE=2 SV=1 10 210 5.0E-17
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 6 195 5.0E-17
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 9 158 6.0E-17
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 6 219 6.0E-17
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 2 206 7.0E-17
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 1 179 8.0E-17
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 8 176 8.0E-17
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 6 204 8.0E-17
sp|O93297|CP2K4_ONCMY Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2k4 PE=2 SV=1 16 195 9.0E-17
sp|P10633|CP2D1_RAT Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 28 213 1.0E-16
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 6 182 1.0E-16
sp|O81928|TCMO_CICAR Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 8 193 1.0E-16
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 6 204 1.0E-16
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 10 176 1.0E-16
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 4 188 2.0E-16
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 1 179 2.0E-16
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 6 209 2.0E-16
sp|Q54LA8|C555A_DICDI Probable cytochrome P450 555A1 OS=Dictyostelium discoideum GN=cyp555A1 PE=3 SV=1 3 209 2.0E-16
sp|Q9V399|CP303_DROME Probable cytochrome P450 303a1 OS=Drosophila melanogaster GN=Cyp303a1 PE=2 SV=1 6 184 2.0E-16
sp|Q43067|TCMO_PEA Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 8 193 2.0E-16
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 1 185 2.0E-16
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 6 195 2.0E-16
sp|B1NF19|C719D_ARGME (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 10 176 2.0E-16
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 6 188 2.0E-16
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 6 203 2.0E-16
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 6 176 2.0E-16
sp|Q9SRQ1|C89A9_ARATH Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 2 190 2.0E-16
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 6 197 2.0E-16
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 6 161 3.0E-16
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 6 188 3.0E-16
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 6 204 4.0E-16
sp|Q9VG17|CP304_DROME Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 28 190 4.0E-16
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 3 207 4.0E-16
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 4 182 4.0E-16
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 6 195 5.0E-16
sp|Q1ZXF3|C5172_DICDI Probable cytochrome P450 517A2 OS=Dictyostelium discoideum GN=cyp517A2 PE=3 SV=1 53 187 5.0E-16
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 9 188 5.0E-16
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 6 190 5.0E-16
sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 2 173 5.0E-16
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 6 176 6.0E-16
sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 2 173 7.0E-16
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 6 176 7.0E-16
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 6 204 7.0E-16
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 6 161 8.0E-16
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 5 214 8.0E-16
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 10 203 8.0E-16
sp|Q1ZXI7|C513F_DICDI Probable cytochrome P450 513F1 OS=Dictyostelium discoideum GN=cyp513F1 PE=3 SV=1 3 186 9.0E-16
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 3 189 1.0E-15
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 6 188 1.0E-15
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 3 189 1.0E-15
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 3 189 1.0E-15
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 2 204 1.0E-15
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 3 188 1.0E-15
sp|O93299|CP2K3_ONCMY Cytochrome P450 2K3 OS=Oncorhynchus mykiss GN=cyp2k3 PE=2 SV=1 6 188 1.0E-15
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 6 176 1.0E-15
sp|Q6J540|C79D4_LOTJA Isoleucine N-monooxygenase 2 OS=Lotus japonicus GN=CYP79D4 PE=1 SV=1 4 190 1.0E-15
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 10 204 2.0E-15
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 6 195 2.0E-15
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 9 202 2.0E-15
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 9 196 2.0E-15
sp|P37114|TCMO_MEDSA Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1 2 193 2.0E-15
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 2 184 3.0E-15
sp|Q42602|C89A2_ARATH Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2 2 190 3.0E-15
sp|Q1ZXG3|C522A_DICDI Probable cytochrome P450 522A1 OS=Dictyostelium discoideum GN=cyp522A1 PE=3 SV=1 6 186 3.0E-15
sp|Q54LT7|C519E_DICDI Probable cytochrome P450 519E1 OS=Dictyostelium discoideum GN=cyp519E1 PE=3 SV=1 2 210 3.0E-15
sp|O48957|C99A1_SORBI Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1 6 176 4.0E-15
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 6 176 4.0E-15
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 9 196 4.0E-15
sp|Q54ZM4|C518A_DICDI Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 2 211 4.0E-15
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 1 179 4.0E-15
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 1 179 4.0E-15
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 2 176 4.0E-15
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 2 176 5.0E-15
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 6 214 5.0E-15
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 6 182 5.0E-15
sp|O65785|C71B3_ARATH Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 6 176 5.0E-15
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 6 195 6.0E-15
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 9 197 6.0E-15
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 6 213 6.0E-15
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 6 213 6.0E-15
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 9 196 7.0E-15
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 9 196 7.0E-15
sp|O64718|C71B9_ARATH Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3 6 195 7.0E-15
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 6 204 7.0E-15
sp|Q54SV9|C515B_DICDI Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 6 209 8.0E-15
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 6 214 9.0E-15
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 4 183 1.0E-14
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 1 179 1.0E-14
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 6 207 1.0E-14
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 6 202 2.0E-14
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 6 178 2.0E-14
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 6 204 2.0E-14
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 6 189 2.0E-14
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 6 195 2.0E-14
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 6 194 2.0E-14
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 6 215 2.0E-14
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 6 176 3.0E-14
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 7 161 3.0E-14
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 5 206 3.0E-14
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 3 204 3.0E-14
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 6 195 3.0E-14
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 6 194 3.0E-14
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 6 182 3.0E-14
sp|P90771|C36A1_CAEEL Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 6 205 3.0E-14
sp|O81345|C79B1_SINAL Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 6 177 4.0E-14
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 6 189 4.0E-14
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 3 204 4.0E-14
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 6 176 4.0E-14
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 4 186 4.0E-14
sp|Q6J541|C79D3_LOTJA Isoleucine N-monooxygenase 1 OS=Lotus japonicus GN=CYP79D3 PE=1 SV=1 6 188 4.0E-14
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 9 176 5.0E-14
sp|O81346|C79B2_ARATH Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 6 177 5.0E-14
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 3 189 6.0E-14
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 9 176 7.0E-14
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 10 176 7.0E-14
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 5 189 7.0E-14
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 3 204 7.0E-14
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 6 204 1.0E-13
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 10 176 1.0E-13
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 6 214 1.0E-13
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 2 213 1.0E-13
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 3 195 1.0E-13
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 6 168 2.0E-13
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 6 189 2.0E-13
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 6 214 2.0E-13
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 6 179 2.0E-13
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 2 176 2.0E-13
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 6 176 2.0E-13
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 6 179 2.0E-13
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 6 204 2.0E-13
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 6 214 2.0E-13
sp|Q86A22|C515A_DICDI Probable cytochrome P450 515A1 OS=Dictyostelium discoideum GN=cyp515A1 PE=3 SV=1 6 209 2.0E-13
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 6 189 3.0E-13
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 3 204 3.0E-13
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 10 176 3.0E-13
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 2 176 3.0E-13
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 2 181 3.0E-13
sp|Q1ZXL2|C518B_DICDI Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 2 209 3.0E-13
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 6 176 4.0E-13
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 6 183 5.0E-13
sp|Q43135|C79A1_SORBI Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3 6 177 5.0E-13
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 1 179 6.0E-13
sp|A0A087X1C5|CP2D7_HUMAN Putative cytochrome P450 2D7 OS=Homo sapiens GN=CYP2D7 PE=5 SV=1 1 185 7.0E-13
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 4 204 7.0E-13
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 3 209 7.0E-13
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 6 189 8.0E-13
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 3 189 8.0E-13
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 9 196 8.0E-13
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 9 196 8.0E-13
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 9 204 8.0E-13
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 6 206 9.0E-13
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 6 177 1.0E-12
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 3 195 1.0E-12
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 6 213 1.0E-12
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 5 210 1.0E-12
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 6 161 1.0E-12
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 5 174 1.0E-12
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 5 185 1.0E-12
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 9 195 2.0E-12
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 5 208 2.0E-12
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 6 214 2.0E-12
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 6 189 2.0E-12
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 5 208 2.0E-12
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 2 176 2.0E-12
sp|Q501D8|C79B3_ARATH Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 6 176 2.0E-12
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 5 174 2.0E-12
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 7 176 2.0E-12
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 1 189 2.0E-12
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 3 199 3.0E-12
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 8 177 3.0E-12
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 6 213 3.0E-12
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 9 201 3.0E-12
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 6 195 3.0E-12
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 6 187 4.0E-12
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 5 180 4.0E-12
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 6 209 4.0E-12
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 2 176 4.0E-12
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 1 189 4.0E-12
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 6 213 4.0E-12
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 3 194 4.0E-12
sp|Q54D38|C520A_DICDI Probable cytochrome P450 520A1 OS=Dictyostelium discoideum GN=cyp520A1 PE=3 SV=1 2 209 5.0E-12
sp|H2DH20|C7D13_PANGI Cytochrome P450 CYP71D313 OS=Panax ginseng PE=2 SV=1 6 177 6.0E-12
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 8 182 6.0E-12
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 6 176 7.0E-12
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 6 182 7.0E-12
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 6 207 7.0E-12
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 5 190 8.0E-12
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 6 176 8.0E-12
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 6 214 8.0E-12
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 3 178 9.0E-12
sp|Q54SN0|C513E_DICDI Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 6 173 9.0E-12
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 9 176 1.0E-11
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 5 207 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4893
MLASALMIGGVESTASIIQWFQALIPSYPEVQRRAHDELDCVVGRDRLPGVEDEKDLPYCRAIIKEVERCYAPFW
LGNPHQVTEDFVYKEQFIPKDALLIVNAWSIHHNDDRFPEPQRFNPERYINDTLSSAQSANLADASQRDHWIFGA
GRRICPAMDVAEREIWLSISRMLWSFTIEAVPEQPIDLKQYDGLSGRSPMPFKVRLRVRDDNVTRVLKESMPT*
Coding >OphauB2|4893
ATGTTGGCCTCAGCCCTGATGATTGGGGGGGTAGAGAGTACAGCATCTATCATACAATGGTTTCAAGCACTTATT
CCTTCATACCCTGAAGTTCAGCGGCGCGCCCATGATGAGTTAGATTGCGTTGTCGGACGAGACCGTTTGCCTGGC
GTCGAGGACGAAAAAGATCTTCCTTACTGCCGTGCTATTATTAAAGAAGTGGAGAGATGCTACGCTCCATTTTGG
CTAGGAAATCCTCACCAGGTTACCGAAGATTTTGTCTATAAGGAACAATTTATCCCCAAGGACGCATTGCTCATA
GTCAATGCATGGAGCATTCATCATAACGATGATCGGTTTCCAGAACCACAAAGGTTCAATCCCGAACGTTACATC
AACGACACCCTCTCGTCTGCACAGAGTGCCAACTTGGCCGACGCTAGCCAGCGCGACCACTGGATTTTTGGCGCC
GGACGGCGAATTTGCCCCGCCATGGACGTAGCCGAGCGCGAGATATGGCTGTCAATTTCTCGCATGCTTTGGTCT
TTTACTATAGAGGCTGTTCCGGAACAGCCCATTGATCTGAAACAGTACGATGGCTTGTCGGGAAGATCACCTATG
CCATTCAAGGTTCGCTTGCGAGTCAGAGACGACAATGTTACTCGGGTTTTGAAGGAATCTATGCCTACTTGA
Transcript >OphauB2|4893
ATGTTGGCCTCAGCCCTGATGATTGGGGGGGTAGAGAGTACAGCATCTATCATACAATGGTTTCAAGCACTTATT
CCTTCATACCCTGAAGTTCAGCGGCGCGCCCATGATGAGTTAGATTGCGTTGTCGGACGAGACCGTTTGCCTGGC
GTCGAGGACGAAAAAGATCTTCCTTACTGCCGTGCTATTATTAAAGAAGTGGAGAGATGCTACGCTCCATTTTGG
CTAGGAAATCCTCACCAGGTTACCGAAGATTTTGTCTATAAGGAACAATTTATCCCCAAGGACGCATTGCTCATA
GTCAATGCATGGAGCATTCATCATAACGATGATCGGTTTCCAGAACCACAAAGGTTCAATCCCGAACGTTACATC
AACGACACCCTCTCGTCTGCACAGAGTGCCAACTTGGCCGACGCTAGCCAGCGCGACCACTGGATTTTTGGCGCC
GGACGGCGAATTTGCCCCGCCATGGACGTAGCCGAGCGCGAGATATGGCTGTCAATTTCTCGCATGCTTTGGTCT
TTTACTATAGAGGCTGTTCCGGAACAGCCCATTGATCTGAAACAGTACGATGGCTTGTCGGGAAGATCACCTATG
CCATTCAAGGTTCGCTTGCGAGTCAGAGACGACAATGTTACTCGGGTTTTGAAGGAATCTATGCCTACTTGA
Gene >OphauB2|4893
ATGTTGGCCTCAGCCCTGATGATTGGGGGGGTAGAGAGTGTATGATTGTTCTTCTTTTCCCCTAACACTCCTACA
TACAATCGCTGCTGACACTTTTGGATTGAACAAGACAGCATCTATCATACAATGGTTTCAAGCACTTATTCCTTC
ATACCCTGAAGTTCAGCGGCGCGCCCATGATGAGTTAGATTGCGTTGTCGGACGAGACCGTTTGCCTGGCGTCGA
GGACGAAAAAGATCTTCCTTACTGCCGTGCTATTATTAAAGAAGTGGAGAGATGCTACGCTCCATTTTGGCTAGG
AAATCCTCACCAGGTTACCGAAGATTTTGTCTATAAGGAACAATTTATCCCCAAGGACGCATTGCTCATAGTCAA
TGCATGGAGCATTCATCATAACGATGATCGGTTTCCAGAACCACAAAGGTTCAATGTGAGTCCAAGCTTTGCCAA
GTCTGTAGAGCCGCACATTAAAACACTTGCTACAGCCCGAACGTTACATCAACGACACCCTCTCGTCTGCACAGA
GTGCCAACTTGGCCGACGCTAGCCAGCGCGACCACTGGATTTTTGGCGCCGGACGGCGAATTTGCCCCGCCATGG
ACGTAGCCGAGCGCGAGATATGGCTGTCAATTTCTCGCATGCTTTGGTCTTTTACTATAGAGGCTGTTCCGGAAC
AGCCCATTGATCTGAAACAGTACGATGGCTTGTCGGGAAGATCACCTATGCCATTCAAGGTTCGCTTGCGAGTCA
GAGACGACAATGTTACTCGGGTTTTGAAGGAATCTATGCCTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail