Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4891
Gene name
LocationContig_347:405..3168
Strand+
Gene length (bp)2763
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.1E+01 203 230
PF08238 Sel1 Sel1 repeat 2.6E-01 263 289
PF08238 Sel1 Sel1 repeat 1.4E+02 348 382
PF08238 Sel1 Sel1 repeat 1.8E-01 385 419
PF08238 Sel1 Sel1 repeat 1.6E-04 424 457

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 104 469 2.0E-42
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 189 476 5.0E-31
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 180 468 1.0E-25
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 214 467 2.0E-21
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 184 417 9.0E-14

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1756
Ophiocordyceps australis map64 (Brazil) OphauB2|4891 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01769
Ophiocordyceps camponoti-rufipedis Ophun1|1006
Ophiocordyceps kimflemingae Ophio5|4969
Ophiocordyceps subramaniannii Hirsu2|9772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4891
MADLGATFVPGGADDYFLPQVVSPAPQRITPQVPQNMQDDLQRLELDDSNDAHRIRGQSMAHHVSSHQATTAGET
DIRAYRDIDNSSRSRVLDGMDWNAPSLSPFPKVTGDNVPPGDDAKEEILWNARKHVLNSQNVTMQISWARDVLIW
AEIAMDAAAREPGGKARPATPRIEHELRIDALNIVSYLAQQDHPDALYIQSKWLEFGKFGHRVDKREAFNGYRRA
AELGNARSEYRMGMLFEQSNDMPRAKEHYCRGMALDDSAALYRMGMMSLLGQHGETRDYPRGLERIQAAAEGADE
DAPQGSYVYGMLLGRELPDISIPDRLLPMKLESAKMYVEKAAYLGFAKAQLKMGQAYELCQLSCDFYPSYSLHYY
GLAAKQGLPEAALGVSRWFLFGYEGVFKKNEELAFRYAHEAAMAKLATGEFAMGYYHEIGIHVAKQIDEARRWYR
LAADHGNKDALGRLESLDQHRSLSKADHETTTLTRIKSQHGSQKGKRPERLKQLSQQMPTLSEGSTPSTPLDTGP
RPGVKSPATVASPRISPHPSPGLRPTIVSEPTAFPDPLRASVVASDRQNSAFAMRAGSGQGRATGPLSDNQAYRA
TSSHSTAPYPEDDVHEEWQGSSGLVGSSALRLEAEGPVSAFGIKQQTAGPRPMPGSNSTASLSQPSARDRNASAG
HESLKVGSYAQGNLASGGRSYLGDDVQTRPAASLPYPTTNRLQKQPCSYSSPAGLDATREYGPCRSWSRPVSEVA
GQHNGHGLGAAGSRPERLSSLPPPDIARPPRTASGTAAMSMPMSPRLGTGGRTGSAPPGQTGHERLSPAAQSSAS
VAAKPIKGPATFEDMGIPQGKKESDCVLM*
Coding >OphauB2|4891
ATGGCTGACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGATGATTACTTTTTACCCCAAGTCGTTTCTCCTGCG
CCGCAAAGAATAACACCCCAGGTTCCTCAAAATATGCAGGACGACTTGCAACGCCTTGAACTCGATGATAGCAAC
GACGCTCATCGCATCCGCGGTCAGTCCATGGCGCACCACGTCTCGTCTCACCAGGCGACTACGGCGGGCGAGACG
GATATCAGAGCGTATCGAGACATTGACAACAGTAGCCGCTCTCGGGTCCTCGACGGCATGGATTGGAATGCGCCC
TCCTTGTCACCCTTTCCCAAGGTTACCGGCGACAACGTGCCGCCAGGCGACGACGCAAAAGAGGAAATTTTGTGG
AATGCGCGCAAGCATGTCCTCAACTCGCAAAACGTCACCATGCAGATAAGCTGGGCCCGTGATGTTCTCATCTGG
GCTGAGATTGCCATGGACGCTGCCGCCCGCGAGCCAGGTGGCAAGGCGCGGCCAGCAACGCCGCGTATCGAGCAC
GAGCTGCGTATTGATGCTCTCAATATTGTTAGTTATTTGGCCCAGCAGGACCATCCCGACGCCCTCTACATACAA
TCCAAATGGCTCGAGTTTGGAAAGTTTGGACACCGCGTCGATAAGCGCGAGGCCTTTAATGGCTACCGACGCGCG
GCCGAGCTGGGAAATGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATGCCCAGAGCC
AAGGAACACTACTGCAGGGGCATGGCTCTCGATGACTCAGCTGCCCTTTACCGCATGGGAATGATGAGTCTGCTT
GGCCAGCATGGTGAGACGCGAGACTATCCCAGAGGCCTAGAGCGCATTCAGGCCGCCGCCGAAGGCGCAGATGAG
GACGCTCCTCAGGGCTCTTATGTGTACGGCATGCTTCTCGGCCGGGAACTTCCAGACATCTCAATTCCAGATAGA
CTGTTACCCATGAAGCTTGAATCGGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTTGCCAAGGCTCAG
CTCAAAATGGGCCAGGCATATGAGCTGTGCCAGTTGAGTTGCGATTTCTATCCCTCGTACTCGCTGCACTACTAT
GGCCTGGCAGCCAAGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGCCGCTGGTTCCTTTTTGGATATGAAGGT
GTCTTTAAGAAGAACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCATGGCCAAACTAGCAACTGGCGAA
TTTGCCATGGGATACTACCACGAAATCGGGATCCATGTGGCCAAGCAGATTGACGAGGCGCGGCGGTGGTACAGG
CTCGCCGCCGACCACGGAAACAAGGACGCTCTGGGACGTCTTGAATCGCTTGACCAGCACAGAAGCCTGTCCAAG
GCGGACCACGAGACGACAACCTTGACTCGCATCAAGTCGCAGCACGGGTCCCAGAAGGGCAAGAGACCGGAGCGG
CTCAAGCAGCTCTCGCAGCAGATGCCGACACTGAGCGAAGGCAGCACACCATCGACACCCCTGGATACAGGCCCG
AGACCTGGGGTCAAATCCCCCGCCACCGTGGCATCTCCCCGCATTTCGCCTCATCCGTCGCCAGGTCTGAGGCCG
ACCATTGTATCGGAGCCGACTGCCTTCCCCGATCCCTTGAGGGCATCCGTGGTTGCCTCGGACCGACAAAACTCA
GCTTTTGCTATGCGAGCCGGTAGTGGCCAAGGGCGTGCAACCGGCCCTTTGTCGGACAATCAAGCATATCGTGCA
ACGTCGTCTCATTCTACCGCCCCGTATCCTGAGGATGATGTACATGAGGAATGGCAGGGCTCGAGTGGCCTAGTT
GGCTCCTCGGCGCTCCGTCTCGAGGCAGAGGGGCCTGTGAGCGCGTTTGGCATCAAGCAACAAACGGCGGGGCCA
CGCCCCATGCCAGGTTCAAATAGCACCGCAAGTTTATCACAGCCCTCTGCTCGCGACAGAAATGCGTCTGCTGGG
CATGAGAGCCTCAAGGTCGGAAGCTACGCGCAAGGCAATCTTGCCTCGGGTGGCCGCTCATACCTGGGAGACGAC
GTGCAAACGCGGCCGGCAGCGTCTCTCCCCTATCCGACGACCAACAGACTGCAGAAGCAGCCATGTTCGTATTCG
TCGCCGGCTGGATTAGATGCGACGCGCGAGTACGGGCCATGTCGGTCCTGGTCACGTCCAGTGTCCGAGGTTGCT
GGCCAGCACAATGGTCACGGCCTTGGGGCAGCAGGCAGCAGGCCCGAACGGCTCAGTTCATTACCGCCCCCTGAT
ATTGCCAGACCACCAAGGACGGCGTCTGGCACAGCAGCAATGTCGATGCCAATGTCGCCCCGATTGGGTACCGGA
GGCAGAACGGGAAGTGCACCCCCGGGACAAACCGGGCATGAGAGGCTAAGCCCGGCAGCACAGAGCTCTGCAAGT
GTCGCGGCAAAGCCGATCAAGGGGCCTGCCACTTTTGAAGACATGGGTATTCCCCAAGGGAAAAAGGAGAGCGAC
TGTGTTCTCATGTGA
Transcript >OphauB2|4891
ATGGCTGACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGATGATTACTTTTTACCCCAAGTCGTTTCTCCTGCG
CCGCAAAGAATAACACCCCAGGTTCCTCAAAATATGCAGGACGACTTGCAACGCCTTGAACTCGATGATAGCAAC
GACGCTCATCGCATCCGCGGTCAGTCCATGGCGCACCACGTCTCGTCTCACCAGGCGACTACGGCGGGCGAGACG
GATATCAGAGCGTATCGAGACATTGACAACAGTAGCCGCTCTCGGGTCCTCGACGGCATGGATTGGAATGCGCCC
TCCTTGTCACCCTTTCCCAAGGTTACCGGCGACAACGTGCCGCCAGGCGACGACGCAAAAGAGGAAATTTTGTGG
AATGCGCGCAAGCATGTCCTCAACTCGCAAAACGTCACCATGCAGATAAGCTGGGCCCGTGATGTTCTCATCTGG
GCTGAGATTGCCATGGACGCTGCCGCCCGCGAGCCAGGTGGCAAGGCGCGGCCAGCAACGCCGCGTATCGAGCAC
GAGCTGCGTATTGATGCTCTCAATATTGTTAGTTATTTGGCCCAGCAGGACCATCCCGACGCCCTCTACATACAA
TCCAAATGGCTCGAGTTTGGAAAGTTTGGACACCGCGTCGATAAGCGCGAGGCCTTTAATGGCTACCGACGCGCG
GCCGAGCTGGGAAATGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATGCCCAGAGCC
AAGGAACACTACTGCAGGGGCATGGCTCTCGATGACTCAGCTGCCCTTTACCGCATGGGAATGATGAGTCTGCTT
GGCCAGCATGGTGAGACGCGAGACTATCCCAGAGGCCTAGAGCGCATTCAGGCCGCCGCCGAAGGCGCAGATGAG
GACGCTCCTCAGGGCTCTTATGTGTACGGCATGCTTCTCGGCCGGGAACTTCCAGACATCTCAATTCCAGATAGA
CTGTTACCCATGAAGCTTGAATCGGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTTGCCAAGGCTCAG
CTCAAAATGGGCCAGGCATATGAGCTGTGCCAGTTGAGTTGCGATTTCTATCCCTCGTACTCGCTGCACTACTAT
GGCCTGGCAGCCAAGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGCCGCTGGTTCCTTTTTGGATATGAAGGT
GTCTTTAAGAAGAACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCATGGCCAAACTAGCAACTGGCGAA
TTTGCCATGGGATACTACCACGAAATCGGGATCCATGTGGCCAAGCAGATTGACGAGGCGCGGCGGTGGTACAGG
CTCGCCGCCGACCACGGAAACAAGGACGCTCTGGGACGTCTTGAATCGCTTGACCAGCACAGAAGCCTGTCCAAG
GCGGACCACGAGACGACAACCTTGACTCGCATCAAGTCGCAGCACGGGTCCCAGAAGGGCAAGAGACCGGAGCGG
CTCAAGCAGCTCTCGCAGCAGATGCCGACACTGAGCGAAGGCAGCACACCATCGACACCCCTGGATACAGGCCCG
AGACCTGGGGTCAAATCCCCCGCCACCGTGGCATCTCCCCGCATTTCGCCTCATCCGTCGCCAGGTCTGAGGCCG
ACCATTGTATCGGAGCCGACTGCCTTCCCCGATCCCTTGAGGGCATCCGTGGTTGCCTCGGACCGACAAAACTCA
GCTTTTGCTATGCGAGCCGGTAGTGGCCAAGGGCGTGCAACCGGCCCTTTGTCGGACAATCAAGCATATCGTGCA
ACGTCGTCTCATTCTACCGCCCCGTATCCTGAGGATGATGTACATGAGGAATGGCAGGGCTCGAGTGGCCTAGTT
GGCTCCTCGGCGCTCCGTCTCGAGGCAGAGGGGCCTGTGAGCGCGTTTGGCATCAAGCAACAAACGGCGGGGCCA
CGCCCCATGCCAGGTTCAAATAGCACCGCAAGTTTATCACAGCCCTCTGCTCGCGACAGAAATGCGTCTGCTGGG
CATGAGAGCCTCAAGGTCGGAAGCTACGCGCAAGGCAATCTTGCCTCGGGTGGCCGCTCATACCTGGGAGACGAC
GTGCAAACGCGGCCGGCAGCGTCTCTCCCCTATCCGACGACCAACAGACTGCAGAAGCAGCCATGTTCGTATTCG
TCGCCGGCTGGATTAGATGCGACGCGCGAGTACGGGCCATGTCGGTCCTGGTCACGTCCAGTGTCCGAGGTTGCT
GGCCAGCACAATGGTCACGGCCTTGGGGCAGCAGGCAGCAGGCCCGAACGGCTCAGTTCATTACCGCCCCCTGAT
ATTGCCAGACCACCAAGGACGGCGTCTGGCACAGCAGCAATGTCGATGCCAATGTCGCCCCGATTGGGTACCGGA
GGCAGAACGGGAAGTGCACCCCCGGGACAAACCGGGCATGAGAGGCTAAGCCCGGCAGCACAGAGCTCTGCAAGT
GTCGCGGCAAAGCCGATCAAGGGGCCTGCCACTTTTGAAGACATGGGTATTCCCCAAGGGAAAAAGGAGAGCGAC
TGTGTTCTCATGTGA
Gene >OphauB2|4891
ATGGCTGACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGATGATTACTTTTTACCCCAAGTCGTTTCTCCTGCG
CCGCAAAGGTGAGAGATTAAGACGCCTCTGACTGCCTCAGCATAGCGTTGCAGTTTGATATTGGTGCTATGAAAT
TTTTTTTTTTTCGTTTCTTTTTTTTGGGGTGGAGGGGAGGAGGCGGCGATTTGCTGACAGCCTGACCTAGAATAA
CACCCCAGGTTCCTCAAAATATGCAGGACGACTTGCAACGCCTTGAACTCGATGATAGCAACGACGCTCATCGCA
TCCGCGGTCAGTCCATGGCGCACCACGTCTCGTCTCACCAGGCGACTACGGCGGGCGAGACGGATATCAGAGCGT
ATCGAGACATTGACAACAGTAGCCGCTCTCGGGTCCTCGACGGCATGGATTGGAATGCGCCCTCCTTGTCACCCT
TTCCCAAGGTTACCGGCGACAACGTGCCGCCAGGCGACGACGCAAAAGAGGAAATTTTGTGGAATGCGCGCAAGC
ATGTCCTCAACTCGCAAAACGTCACCATGCAGATAAGCTGGGCCCGTGATGTTCTCATCTGGGCTGAGATTGCCA
TGGACGCTGCCGCCCGCGAGCCAGGTGGCAAGGCGCGGCCAGCAACGCCGCGTATCGAGCACGAGCTGCGTATTG
ATGCTCTCAATATTGTTAGTTATTTGGCCCAGCAGGACCATCCCGACGCCCTCTACATACAATCCAAATGGCTCG
AGTTTGGAAAGTTTGGACACCGCGTCGATAAGCGCGAGGCCTTTAATGGCTACCGACGCGCGGCCGAGCTGGGAA
ATGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATGCCCAGAGCCAAGGAACACTACT
GCAGGGGCATGGCTCTCGATGACTCAGCTGCCCTTTACCGCATGGGAATGATGAGTCTGCTTGGCCAGCATGGTG
AGACGCGAGACTATCCCAGAGGCCTAGAGCGCATTCAGGCCGCCGCCGAAGGCGCAGATGAGGACGCTCCTCAGG
GCTCTTATGTGTACGGCATGCTTCTCGGCCGGGAACTTCCAGACATCTCAATTCCAGATAGACTGTTACCCATGA
AGCTTGAATCGGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTTGCCAAGGCTCAGCTCAAAATGGGCC
AGGCATATGAGCTGTGCCAGTTGAGTTGCGATTTCTATCCCTCGTACTCGCTGCACTACTATGGCCTGGCAGCCA
AGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGCCGCTGGTTCCTTTTTGGATATGAAGGTGTCTTTAAGAAGA
ACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCATGGCCAAACTAGCAACTGGCGAATTTGCCATGGGAT
ACTACCACGAAATCGGGATCCATGTGGCCAAGCAGATTGACGAGGCGCGGCGGTGGTACAGGCTCGCCGCCGACC
ACGGAAACAAGGACGCTCTGGGACGTCTTGAATCGCTTGACCAGCACAGAAGCCTGTCCAAGGCGGACCACGAGA
CGACAACCTTGACTCGCATCAAGTCGCAGCACGGGTCCCAGAAGGGCAAGAGACCGGAGCGGCTCAAGCAGCTCT
CGCAGCAGATGCCGACACTGAGCGAAGGCAGCACACCATCGACACCCCTGGATACAGGCCCGAGACCTGGGGTCA
AATCCCCCGCCACCGTGGCATCTCCCCGCATTTCGCCTCATCCGTCGCCAGGTCTGAGGCCGACCATTGTATCGG
AGCCGACTGCCTTCCCCGATCCCTTGAGGGCATCCGTGGTTGCCTCGGACCGACAAAACTCAGCTTTTGCTATGC
GAGCCGGTAGTGGCCAAGGGCGTGCAACCGGCCCTTTGTCGGACAATCAAGCATATCGTGCAACGTCGTCTCATT
CTACCGCCCCGTATCCTGAGGATGATGTACATGAGGAATGGCAGGGCTCGAGTGGCCTAGTTGGCTCCTCGGCGC
TCCGTCTCGAGGCAGAGGGGCCTGTGAGCGCGTTTGGCATCAAGCAACAAACGGCGGGGCCACGCCCCATGCCAG
GTTCAAATAGCACCGCAAGTTTATCACAGCCCTCTGCTCGCGACAGAAATGCGTCTGCTGGGCATGAGAGCCTCA
AGGTCGGAAGCTACGCGCAAGGCAATCTTGCCTCGGGTGGCCGCTCATACCTGGGAGACGACGTGCAAACGCGGC
CGGCAGCGTCTCTCCCCTATCCGACGACCAACAGACTGCAGAAGCAGCCATGTTCGTATTCGTCGCCGGCTGGAT
TAGATGCGACGCGCGAGTACGGGCCATGTCGGTCCTGGTCACGTCCAGTGTCCGAGGTTGCTGGCCAGCACAATG
GTCACGGCCTTGGGGCAGCAGGCAGCAGGCCCGAACGGCTCAGTTCATTACCGCCCCCTGATATTGCCAGACCAC
CAAGGACGGCGTCTGGCACAGCAGCAATGTCGATGCCAATGTCGCCCCGATTGGGTACCGGAGGCAGAACGGGAA
GTGCACCCCCGGGACAAACCGGGCATGAGAGGCTAAGCCCGGCAGCACAGAGCTCTGCAAGTGTCGCGGCAAAGC
CGATCAAGGGGCCTGCCACTTTTGAAGACATGGGTATTCCCCAAGGGAAAAAGGAGAGCGACTGTGTAAGTAGGC
TCGTTGTGCGTGCATCTCGTCTCGTTTTGACGCCACTGACTGTGCCTCAAGGTTCTCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail