Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4891
Gene name
LocationContig_347:405..3168
Strand+
Gene length (bp)2763
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.1E+01 203 230
PF08238 Sel1 Sel1 repeat 2.6E-01 263 289
PF08238 Sel1 Sel1 repeat 1.4E+02 348 382
PF08238 Sel1 Sel1 repeat 1.8E-01 385 419
PF08238 Sel1 Sel1 repeat 1.6E-04 424 457

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 104 469 2.0E-42
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 189 476 5.0E-31
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 180 468 1.0E-25
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 214 467 2.0E-21
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 184 417 9.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4891
MADLGATFVPGGADDYFLPQVVSPAPQRITPQVPQNMQDDLQRLELDDSNDAHRIRGQSMAHHVSSHQATTAGET
DIRAYRDIDNSSRSRVLDGMDWNAPSLSPFPKVTGDNVPPGDDAKEEILWNARKHVLNSQNVTMQISWARDVLIW
AEIAMDAAAREPGGKARPATPRIEHELRIDALNIVSYLAQQDHPDALYIQSKWLEFGKFGHRVDKREAFNGYRRA
AELGNARSEYRMGMLFEQSNDMPRAKEHYCRGMALDDSAALYRMGMMSLLGQHGETRDYPRGLERIQAAAEGADE
DAPQGSYVYGMLLGRELPDISIPDRLLPMKLESAKMYVEKAAYLGFAKAQLKMGQAYELCQLSCDFYPSYSLHYY
GLAAKQGLPEAALGVSRWFLFGYEGVFKKNEELAFRYAHEAAMAKLATGEFAMGYYHEIGIHVAKQIDEARRWYR
LAADHGNKDALGRLESLDQHRSLSKADHETTTLTRIKSQHGSQKGKRPERLKQLSQQMPTLSEGSTPSTPLDTGP
RPGVKSPATVASPRISPHPSPGLRPTIVSEPTAFPDPLRASVVASDRQNSAFAMRAGSGQGRATGPLSDNQAYRA
TSSHSTAPYPEDDVHEEWQGSSGLVGSSALRLEAEGPVSAFGIKQQTAGPRPMPGSNSTASLSQPSARDRNASAG
HESLKVGSYAQGNLASGGRSYLGDDVQTRPAASLPYPTTNRLQKQPCSYSSPAGLDATREYGPCRSWSRPVSEVA
GQHNGHGLGAAGSRPERLSSLPPPDIARPPRTASGTAAMSMPMSPRLGTGGRTGSAPPGQTGHERLSPAAQSSAS
VAAKPIKGPATFEDMGIPQGKKESDCVLM*
Coding >OphauB2|4891
ATGGCTGACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGATGATTACTTTTTACCCCAAGTCGTTTCTCCTGCG
CCGCAAAGAATAACACCCCAGGTTCCTCAAAATATGCAGGACGACTTGCAACGCCTTGAACTCGATGATAGCAAC
GACGCTCATCGCATCCGCGGTCAGTCCATGGCGCACCACGTCTCGTCTCACCAGGCGACTACGGCGGGCGAGACG
GATATCAGAGCGTATCGAGACATTGACAACAGTAGCCGCTCTCGGGTCCTCGACGGCATGGATTGGAATGCGCCC
TCCTTGTCACCCTTTCCCAAGGTTACCGGCGACAACGTGCCGCCAGGCGACGACGCAAAAGAGGAAATTTTGTGG
AATGCGCGCAAGCATGTCCTCAACTCGCAAAACGTCACCATGCAGATAAGCTGGGCCCGTGATGTTCTCATCTGG
GCTGAGATTGCCATGGACGCTGCCGCCCGCGAGCCAGGTGGCAAGGCGCGGCCAGCAACGCCGCGTATCGAGCAC
GAGCTGCGTATTGATGCTCTCAATATTGTTAGTTATTTGGCCCAGCAGGACCATCCCGACGCCCTCTACATACAA
TCCAAATGGCTCGAGTTTGGAAAGTTTGGACACCGCGTCGATAAGCGCGAGGCCTTTAATGGCTACCGACGCGCG
GCCGAGCTGGGAAATGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATGCCCAGAGCC
AAGGAACACTACTGCAGGGGCATGGCTCTCGATGACTCAGCTGCCCTTTACCGCATGGGAATGATGAGTCTGCTT
GGCCAGCATGGTGAGACGCGAGACTATCCCAGAGGCCTAGAGCGCATTCAGGCCGCCGCCGAAGGCGCAGATGAG
GACGCTCCTCAGGGCTCTTATGTGTACGGCATGCTTCTCGGCCGGGAACTTCCAGACATCTCAATTCCAGATAGA
CTGTTACCCATGAAGCTTGAATCGGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTTGCCAAGGCTCAG
CTCAAAATGGGCCAGGCATATGAGCTGTGCCAGTTGAGTTGCGATTTCTATCCCTCGTACTCGCTGCACTACTAT
GGCCTGGCAGCCAAGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGCCGCTGGTTCCTTTTTGGATATGAAGGT
GTCTTTAAGAAGAACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCATGGCCAAACTAGCAACTGGCGAA
TTTGCCATGGGATACTACCACGAAATCGGGATCCATGTGGCCAAGCAGATTGACGAGGCGCGGCGGTGGTACAGG
CTCGCCGCCGACCACGGAAACAAGGACGCTCTGGGACGTCTTGAATCGCTTGACCAGCACAGAAGCCTGTCCAAG
GCGGACCACGAGACGACAACCTTGACTCGCATCAAGTCGCAGCACGGGTCCCAGAAGGGCAAGAGACCGGAGCGG
CTCAAGCAGCTCTCGCAGCAGATGCCGACACTGAGCGAAGGCAGCACACCATCGACACCCCTGGATACAGGCCCG
AGACCTGGGGTCAAATCCCCCGCCACCGTGGCATCTCCCCGCATTTCGCCTCATCCGTCGCCAGGTCTGAGGCCG
ACCATTGTATCGGAGCCGACTGCCTTCCCCGATCCCTTGAGGGCATCCGTGGTTGCCTCGGACCGACAAAACTCA
GCTTTTGCTATGCGAGCCGGTAGTGGCCAAGGGCGTGCAACCGGCCCTTTGTCGGACAATCAAGCATATCGTGCA
ACGTCGTCTCATTCTACCGCCCCGTATCCTGAGGATGATGTACATGAGGAATGGCAGGGCTCGAGTGGCCTAGTT
GGCTCCTCGGCGCTCCGTCTCGAGGCAGAGGGGCCTGTGAGCGCGTTTGGCATCAAGCAACAAACGGCGGGGCCA
CGCCCCATGCCAGGTTCAAATAGCACCGCAAGTTTATCACAGCCCTCTGCTCGCGACAGAAATGCGTCTGCTGGG
CATGAGAGCCTCAAGGTCGGAAGCTACGCGCAAGGCAATCTTGCCTCGGGTGGCCGCTCATACCTGGGAGACGAC
GTGCAAACGCGGCCGGCAGCGTCTCTCCCCTATCCGACGACCAACAGACTGCAGAAGCAGCCATGTTCGTATTCG
TCGCCGGCTGGATTAGATGCGACGCGCGAGTACGGGCCATGTCGGTCCTGGTCACGTCCAGTGTCCGAGGTTGCT
GGCCAGCACAATGGTCACGGCCTTGGGGCAGCAGGCAGCAGGCCCGAACGGCTCAGTTCATTACCGCCCCCTGAT
ATTGCCAGACCACCAAGGACGGCGTCTGGCACAGCAGCAATGTCGATGCCAATGTCGCCCCGATTGGGTACCGGA
GGCAGAACGGGAAGTGCACCCCCGGGACAAACCGGGCATGAGAGGCTAAGCCCGGCAGCACAGAGCTCTGCAAGT
GTCGCGGCAAAGCCGATCAAGGGGCCTGCCACTTTTGAAGACATGGGTATTCCCCAAGGGAAAAAGGAGAGCGAC
TGTGTTCTCATGTGA
Transcript >OphauB2|4891
ATGGCTGACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGATGATTACTTTTTACCCCAAGTCGTTTCTCCTGCG
CCGCAAAGAATAACACCCCAGGTTCCTCAAAATATGCAGGACGACTTGCAACGCCTTGAACTCGATGATAGCAAC
GACGCTCATCGCATCCGCGGTCAGTCCATGGCGCACCACGTCTCGTCTCACCAGGCGACTACGGCGGGCGAGACG
GATATCAGAGCGTATCGAGACATTGACAACAGTAGCCGCTCTCGGGTCCTCGACGGCATGGATTGGAATGCGCCC
TCCTTGTCACCCTTTCCCAAGGTTACCGGCGACAACGTGCCGCCAGGCGACGACGCAAAAGAGGAAATTTTGTGG
AATGCGCGCAAGCATGTCCTCAACTCGCAAAACGTCACCATGCAGATAAGCTGGGCCCGTGATGTTCTCATCTGG
GCTGAGATTGCCATGGACGCTGCCGCCCGCGAGCCAGGTGGCAAGGCGCGGCCAGCAACGCCGCGTATCGAGCAC
GAGCTGCGTATTGATGCTCTCAATATTGTTAGTTATTTGGCCCAGCAGGACCATCCCGACGCCCTCTACATACAA
TCCAAATGGCTCGAGTTTGGAAAGTTTGGACACCGCGTCGATAAGCGCGAGGCCTTTAATGGCTACCGACGCGCG
GCCGAGCTGGGAAATGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATGCCCAGAGCC
AAGGAACACTACTGCAGGGGCATGGCTCTCGATGACTCAGCTGCCCTTTACCGCATGGGAATGATGAGTCTGCTT
GGCCAGCATGGTGAGACGCGAGACTATCCCAGAGGCCTAGAGCGCATTCAGGCCGCCGCCGAAGGCGCAGATGAG
GACGCTCCTCAGGGCTCTTATGTGTACGGCATGCTTCTCGGCCGGGAACTTCCAGACATCTCAATTCCAGATAGA
CTGTTACCCATGAAGCTTGAATCGGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTTGCCAAGGCTCAG
CTCAAAATGGGCCAGGCATATGAGCTGTGCCAGTTGAGTTGCGATTTCTATCCCTCGTACTCGCTGCACTACTAT
GGCCTGGCAGCCAAGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGCCGCTGGTTCCTTTTTGGATATGAAGGT
GTCTTTAAGAAGAACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCATGGCCAAACTAGCAACTGGCGAA
TTTGCCATGGGATACTACCACGAAATCGGGATCCATGTGGCCAAGCAGATTGACGAGGCGCGGCGGTGGTACAGG
CTCGCCGCCGACCACGGAAACAAGGACGCTCTGGGACGTCTTGAATCGCTTGACCAGCACAGAAGCCTGTCCAAG
GCGGACCACGAGACGACAACCTTGACTCGCATCAAGTCGCAGCACGGGTCCCAGAAGGGCAAGAGACCGGAGCGG
CTCAAGCAGCTCTCGCAGCAGATGCCGACACTGAGCGAAGGCAGCACACCATCGACACCCCTGGATACAGGCCCG
AGACCTGGGGTCAAATCCCCCGCCACCGTGGCATCTCCCCGCATTTCGCCTCATCCGTCGCCAGGTCTGAGGCCG
ACCATTGTATCGGAGCCGACTGCCTTCCCCGATCCCTTGAGGGCATCCGTGGTTGCCTCGGACCGACAAAACTCA
GCTTTTGCTATGCGAGCCGGTAGTGGCCAAGGGCGTGCAACCGGCCCTTTGTCGGACAATCAAGCATATCGTGCA
ACGTCGTCTCATTCTACCGCCCCGTATCCTGAGGATGATGTACATGAGGAATGGCAGGGCTCGAGTGGCCTAGTT
GGCTCCTCGGCGCTCCGTCTCGAGGCAGAGGGGCCTGTGAGCGCGTTTGGCATCAAGCAACAAACGGCGGGGCCA
CGCCCCATGCCAGGTTCAAATAGCACCGCAAGTTTATCACAGCCCTCTGCTCGCGACAGAAATGCGTCTGCTGGG
CATGAGAGCCTCAAGGTCGGAAGCTACGCGCAAGGCAATCTTGCCTCGGGTGGCCGCTCATACCTGGGAGACGAC
GTGCAAACGCGGCCGGCAGCGTCTCTCCCCTATCCGACGACCAACAGACTGCAGAAGCAGCCATGTTCGTATTCG
TCGCCGGCTGGATTAGATGCGACGCGCGAGTACGGGCCATGTCGGTCCTGGTCACGTCCAGTGTCCGAGGTTGCT
GGCCAGCACAATGGTCACGGCCTTGGGGCAGCAGGCAGCAGGCCCGAACGGCTCAGTTCATTACCGCCCCCTGAT
ATTGCCAGACCACCAAGGACGGCGTCTGGCACAGCAGCAATGTCGATGCCAATGTCGCCCCGATTGGGTACCGGA
GGCAGAACGGGAAGTGCACCCCCGGGACAAACCGGGCATGAGAGGCTAAGCCCGGCAGCACAGAGCTCTGCAAGT
GTCGCGGCAAAGCCGATCAAGGGGCCTGCCACTTTTGAAGACATGGGTATTCCCCAAGGGAAAAAGGAGAGCGAC
TGTGTTCTCATGTGA
Gene >OphauB2|4891
ATGGCTGACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGATGATTACTTTTTACCCCAAGTCGTTTCTCCTGCG
CCGCAAAGGTGAGAGATTAAGACGCCTCTGACTGCCTCAGCATAGCGTTGCAGTTTGATATTGGTGCTATGAAAT
TTTTTTTTTTTCGTTTCTTTTTTTTGGGGTGGAGGGGAGGAGGCGGCGATTTGCTGACAGCCTGACCTAGAATAA
CACCCCAGGTTCCTCAAAATATGCAGGACGACTTGCAACGCCTTGAACTCGATGATAGCAACGACGCTCATCGCA
TCCGCGGTCAGTCCATGGCGCACCACGTCTCGTCTCACCAGGCGACTACGGCGGGCGAGACGGATATCAGAGCGT
ATCGAGACATTGACAACAGTAGCCGCTCTCGGGTCCTCGACGGCATGGATTGGAATGCGCCCTCCTTGTCACCCT
TTCCCAAGGTTACCGGCGACAACGTGCCGCCAGGCGACGACGCAAAAGAGGAAATTTTGTGGAATGCGCGCAAGC
ATGTCCTCAACTCGCAAAACGTCACCATGCAGATAAGCTGGGCCCGTGATGTTCTCATCTGGGCTGAGATTGCCA
TGGACGCTGCCGCCCGCGAGCCAGGTGGCAAGGCGCGGCCAGCAACGCCGCGTATCGAGCACGAGCTGCGTATTG
ATGCTCTCAATATTGTTAGTTATTTGGCCCAGCAGGACCATCCCGACGCCCTCTACATACAATCCAAATGGCTCG
AGTTTGGAAAGTTTGGACACCGCGTCGATAAGCGCGAGGCCTTTAATGGCTACCGACGCGCGGCCGAGCTGGGAA
ATGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATGCCCAGAGCCAAGGAACACTACT
GCAGGGGCATGGCTCTCGATGACTCAGCTGCCCTTTACCGCATGGGAATGATGAGTCTGCTTGGCCAGCATGGTG
AGACGCGAGACTATCCCAGAGGCCTAGAGCGCATTCAGGCCGCCGCCGAAGGCGCAGATGAGGACGCTCCTCAGG
GCTCTTATGTGTACGGCATGCTTCTCGGCCGGGAACTTCCAGACATCTCAATTCCAGATAGACTGTTACCCATGA
AGCTTGAATCGGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTTGCCAAGGCTCAGCTCAAAATGGGCC
AGGCATATGAGCTGTGCCAGTTGAGTTGCGATTTCTATCCCTCGTACTCGCTGCACTACTATGGCCTGGCAGCCA
AGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGCCGCTGGTTCCTTTTTGGATATGAAGGTGTCTTTAAGAAGA
ACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCATGGCCAAACTAGCAACTGGCGAATTTGCCATGGGAT
ACTACCACGAAATCGGGATCCATGTGGCCAAGCAGATTGACGAGGCGCGGCGGTGGTACAGGCTCGCCGCCGACC
ACGGAAACAAGGACGCTCTGGGACGTCTTGAATCGCTTGACCAGCACAGAAGCCTGTCCAAGGCGGACCACGAGA
CGACAACCTTGACTCGCATCAAGTCGCAGCACGGGTCCCAGAAGGGCAAGAGACCGGAGCGGCTCAAGCAGCTCT
CGCAGCAGATGCCGACACTGAGCGAAGGCAGCACACCATCGACACCCCTGGATACAGGCCCGAGACCTGGGGTCA
AATCCCCCGCCACCGTGGCATCTCCCCGCATTTCGCCTCATCCGTCGCCAGGTCTGAGGCCGACCATTGTATCGG
AGCCGACTGCCTTCCCCGATCCCTTGAGGGCATCCGTGGTTGCCTCGGACCGACAAAACTCAGCTTTTGCTATGC
GAGCCGGTAGTGGCCAAGGGCGTGCAACCGGCCCTTTGTCGGACAATCAAGCATATCGTGCAACGTCGTCTCATT
CTACCGCCCCGTATCCTGAGGATGATGTACATGAGGAATGGCAGGGCTCGAGTGGCCTAGTTGGCTCCTCGGCGC
TCCGTCTCGAGGCAGAGGGGCCTGTGAGCGCGTTTGGCATCAAGCAACAAACGGCGGGGCCACGCCCCATGCCAG
GTTCAAATAGCACCGCAAGTTTATCACAGCCCTCTGCTCGCGACAGAAATGCGTCTGCTGGGCATGAGAGCCTCA
AGGTCGGAAGCTACGCGCAAGGCAATCTTGCCTCGGGTGGCCGCTCATACCTGGGAGACGACGTGCAAACGCGGC
CGGCAGCGTCTCTCCCCTATCCGACGACCAACAGACTGCAGAAGCAGCCATGTTCGTATTCGTCGCCGGCTGGAT
TAGATGCGACGCGCGAGTACGGGCCATGTCGGTCCTGGTCACGTCCAGTGTCCGAGGTTGCTGGCCAGCACAATG
GTCACGGCCTTGGGGCAGCAGGCAGCAGGCCCGAACGGCTCAGTTCATTACCGCCCCCTGATATTGCCAGACCAC
CAAGGACGGCGTCTGGCACAGCAGCAATGTCGATGCCAATGTCGCCCCGATTGGGTACCGGAGGCAGAACGGGAA
GTGCACCCCCGGGACAAACCGGGCATGAGAGGCTAAGCCCGGCAGCACAGAGCTCTGCAAGTGTCGCGGCAAAGC
CGATCAAGGGGCCTGCCACTTTTGAAGACATGGGTATTCCCCAAGGGAAAAAGGAGAGCGACTGTGTAAGTAGGC
TCGTTGTGCGTGCATCTCGTCTCGTTTTGACGCCACTGACTGTGCCTCAAGGTTCTCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail