Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4890
Gene name
LocationContig_346:2255..3848
Strand+
Gene length (bp)1593
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74949|YJBC_SCHPO Uncharacterized protein C553.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.12c PE=4 SV=2 3 485 8.0E-84

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 88 110 22
3 123 145 22
4 218 240 22
5 260 282 22
6 295 312 17
7 327 349 22
8 370 392 22
9 412 434 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4890
MLPTQAVAWCSVPFPKYPLPYQDDNDDDDDLDRDPLGGHKTPGHGTARVKVNFWFFLLVYYALYNLTALIWITKV
FNLYRLNWWPKSLGFPLTVSLIAVLSLAVPIPVYLVPETRFLTLHNLTWISWSFTIMAMPVAIAFVILMANQRHL
SLRHSLSETQRIFTTSWWTGEPDSLPRQDTTGRPRRQHGARASLDELDPDIFNARPQAVTMCRTWLPFSFVRFLW
FCVALLIGLLAYVLGEAYAEIYLRTLPHNSLETVVYVYGWVGTVHLLDALTGWVLGGRQGERVDSYPLSWVFKLY
FMLTYQTYVRALYARLRSPEQFVVLQLLSSMSLVVLTPLMMTRCFHWILTVTGLSAQSYASYQKLQARNVFIRFV
AENASMAAFLGSIVVLHFGANKDAYPYFAFDDPDEPYGFGLTMTASAVTWACELVASLAVRVLIRLCFAIDVEAE
GKLDIAVSPELLPTSVAVTLHVLQNMLFSIIRLQFYH*
Coding >OphauB2|4890
ATGCTGCCCACGCAGGCCGTTGCTTGGTGCTCTGTGCCCTTTCCAAAGTATCCGCTGCCGTATCAAGACGACAAC
GACGACGATGACGACTTGGACAGAGACCCATTGGGCGGACACAAGACGCCAGGCCACGGCACAGCGCGTGTCAAG
GTCAACTTTTGGTTCTTTCTCCTTGTCTACTATGCCTTGTACAATCTCACGGCATTGATATGGATAACCAAAGTC
TTCAATCTATACCGCCTCAACTGGTGGCCCAAGTCGCTCGGCTTTCCCTTGACCGTTTCTCTCATAGCCGTGCTG
TCGCTGGCGGTGCCAATACCCGTATACCTGGTGCCCGAGACTCGCTTCCTGACGCTGCACAATCTGACGTGGATC
TCTTGGAGTTTTACAATCATGGCTATGCCCGTGGCCATTGCCTTTGTCATTCTCATGGCCAACCAGCGACACCTG
AGTCTGCGCCACTCTCTTTCCGAGACGCAGCGCATCTTCACCACGTCTTGGTGGACGGGCGAGCCCGACTCACTG
CCGCGACAAGACACAACCGGCCGACCGCGGCGCCAACATGGGGCTCGCGCGTCTCTTGACGAGCTTGACCCCGAT
ATTTTCAACGCCAGGCCTCAGGCTGTCACCATGTGCCGCACCTGGCTTCCCTTTAGCTTTGTCCGCTTTCTCTGG
TTCTGCGTCGCCCTCCTGATTGGTCTGCTGGCATACGTCCTCGGCGAGGCCTACGCCGAAATCTACCTACGTACT
TTGCCTCACAACAGTCTCGAGACTGTTGTGTACGTCTACGGCTGGGTGGGCACTGTGCACCTTCTCGACGCCTTG
ACTGGCTGGGTGCTGGGCGGTCGCCAGGGGGAGCGTGTTGACAGCTACCCGCTGAGCTGGGTCTTTAAGCTCTAC
TTCATGCTGACGTACCAGACGTATGTGCGCGCGCTGTATGCGCGACTGCGATCGCCCGAGCAGTTTGTGGTCCTG
CAGTTACTCTCGTCCATGAGCCTCGTGGTTCTAACGCCGCTCATGATGACGCGCTGCTTTCACTGGATCCTGACA
GTAACGGGGCTGAGCGCCCAAAGCTACGCTTCGTACCAAAAGCTGCAAGCGCGCAACGTCTTTATTCGCTTCGTG
GCCGAGAATGCCTCCATGGCGGCCTTTCTCGGTAGCATCGTGGTGCTGCACTTTGGCGCAAACAAGGACGCCTAT
CCCTACTTTGCCTTTGACGACCCCGACGAGCCATATGGCTTTGGGCTTACCATGACGGCCTCGGCTGTGACGTGG
GCGTGCGAGCTCGTTGCCAGCCTGGCCGTCCGCGTACTCATTCGCCTGTGTTTCGCCATTGACGTTGAGGCTGAG
GGCAAGCTCGACATTGCCGTGTCGCCAGAGCTGCTGCCAACTAGCGTGGCTGTGACGCTGCACGTGCTGCAAAAC
ATGCTCTTTTCCATTATCCGACTGCAGTTTTACCACTGA
Transcript >OphauB2|4890
ATGCTGCCCACGCAGGCCGTTGCTTGGTGCTCTGTGCCCTTTCCAAAGTATCCGCTGCCGTATCAAGACGACAAC
GACGACGATGACGACTTGGACAGAGACCCATTGGGCGGACACAAGACGCCAGGCCACGGCACAGCGCGTGTCAAG
GTCAACTTTTGGTTCTTTCTCCTTGTCTACTATGCCTTGTACAATCTCACGGCATTGATATGGATAACCAAAGTC
TTCAATCTATACCGCCTCAACTGGTGGCCCAAGTCGCTCGGCTTTCCCTTGACCGTTTCTCTCATAGCCGTGCTG
TCGCTGGCGGTGCCAATACCCGTATACCTGGTGCCCGAGACTCGCTTCCTGACGCTGCACAATCTGACGTGGATC
TCTTGGAGTTTTACAATCATGGCTATGCCCGTGGCCATTGCCTTTGTCATTCTCATGGCCAACCAGCGACACCTG
AGTCTGCGCCACTCTCTTTCCGAGACGCAGCGCATCTTCACCACGTCTTGGTGGACGGGCGAGCCCGACTCACTG
CCGCGACAAGACACAACCGGCCGACCGCGGCGCCAACATGGGGCTCGCGCGTCTCTTGACGAGCTTGACCCCGAT
ATTTTCAACGCCAGGCCTCAGGCTGTCACCATGTGCCGCACCTGGCTTCCCTTTAGCTTTGTCCGCTTTCTCTGG
TTCTGCGTCGCCCTCCTGATTGGTCTGCTGGCATACGTCCTCGGCGAGGCCTACGCCGAAATCTACCTACGTACT
TTGCCTCACAACAGTCTCGAGACTGTTGTGTACGTCTACGGCTGGGTGGGCACTGTGCACCTTCTCGACGCCTTG
ACTGGCTGGGTGCTGGGCGGTCGCCAGGGGGAGCGTGTTGACAGCTACCCGCTGAGCTGGGTCTTTAAGCTCTAC
TTCATGCTGACGTACCAGACGTATGTGCGCGCGCTGTATGCGCGACTGCGATCGCCCGAGCAGTTTGTGGTCCTG
CAGTTACTCTCGTCCATGAGCCTCGTGGTTCTAACGCCGCTCATGATGACGCGCTGCTTTCACTGGATCCTGACA
GTAACGGGGCTGAGCGCCCAAAGCTACGCTTCGTACCAAAAGCTGCAAGCGCGCAACGTCTTTATTCGCTTCGTG
GCCGAGAATGCCTCCATGGCGGCCTTTCTCGGTAGCATCGTGGTGCTGCACTTTGGCGCAAACAAGGACGCCTAT
CCCTACTTTGCCTTTGACGACCCCGACGAGCCATATGGCTTTGGGCTTACCATGACGGCCTCGGCTGTGACGTGG
GCGTGCGAGCTCGTTGCCAGCCTGGCCGTCCGCGTACTCATTCGCCTGTGTTTCGCCATTGACGTTGAGGCTGAG
GGCAAGCTCGACATTGCCGTGTCGCCAGAGCTGCTGCCAACTAGCGTGGCTGTGACGCTGCACGTGCTGCAAAAC
ATGCTCTTTTCCATTATCCGACTGCAGTTTTACCACTGA
Gene >OphauB2|4890
ATGCTGCCCACGCAGGCCGTTGCTTGGTGCTCTGTGCCCTTTCCAAAGTATCCGCTGCCGTATCAAGACGACAAC
GACGACGATGACGACTTGGACAGAGACCCATTGGGCGGACACAAGACGCCAGGCCACGGCACAGCGCGTGTCAAG
GTCAACTTTTGGTTCTTTCTCCTTGTCTACTATGCCTTGTACAATCTCACGGCATTGATATGGATAACCAAAGTC
TTCAATCTATACCGCCTCAACTGGTGAGTGACTGTTGAGCAAGCCAACGACTTGACCGAGTGTGCTGAGGCCTGT
GCAGGTGGCCCAAGTCGCTCGGCTTTCCCTTGACCGTTTCTCTCATAGCCGTGCTGTCGCTGGCGGTGCCAATAC
CCGTATACCTGGTGCCCGAGACTCGCTTCCTGACGCTGCACAATCTGACGTGGATCTCTTGGAGTTTTACAATCA
TGGCTATGCCCGTGGCCATTGCCTTTGTCATTCTCATGGCCAACCAGCGACACCTGAGTCTGCGCCACTCTCTTT
CCGAGACGCAGCGCATCTTCACCACGTCTTGGTGGACGGGCGAGCCCGACTCACTGCCGCGACAAGACACAACCG
GCCGACCGCGGCGCCAACATGGGGCTCGCGCGTCTCTTGACGAGCTTGACCCCGATATTTTCAACGCCAGGCCTC
AGGCTGTCACCATGTGCCGCACCTGGCTTCCCTTTAGCTTTGTCCGCTTTCTCTGGTTCTGCGTCGCCCTCCTGA
TTGGTCTGCTGGCATACGTCCTCGGCGAGGCCTACGCCGAAATCTACCTACGTACTTTGCCTCACAACAGTCTCG
AGACTGTTGTGTACGTCTACGGCTGGGTGGGCACTGTGCACCTTCTCGACGCCTTGACTGGCTGGGTGCTGGGCG
GTCGCCAGGGGGAGCGTGTTGACAGCTACCCGCTGAGCTGGGTCTTTAAGCTGTGCGTTTTCAAGGCCTCTTGAA
CCTTTTTTTTTCCTTCTTTTTCTTTTACTGACACGACTTTTGCCCAACAGCTACTTCATGCTGACGTACCAGACG
TATGTGCGCGCGCTGTATGCGCGACTGCGATCGCCCGAGCAGTTTGTGGTCCTGCAGTTACTCTCGTCCATGAGC
CTCGTGGTTCTAACGCCGCTCATGATGACGCGCTGCTTTCACTGGATCCTGACAGTAACGGGGCTGAGCGCCCAA
AGCTACGCTTCGTACCAAAAGCTGCAAGCGCGCAACGTCTTTATTCGCTTCGTGGCCGAGAATGCCTCCATGGCG
GCCTTTCTCGGTAGCATCGTGGTGCTGCACTTTGGCGCAAACAAGGACGCCTATCCCTACTTTGCCTTTGACGAC
CCCGACGAGCCATATGGCTTTGGGCTTACCATGACGGCCTCGGCTGTGACGTGGGCGTGCGAGCTCGTTGCCAGC
CTGGCCGTCCGCGTACTCATTCGCCTGTGTTTCGCCATTGACGTTGAGGCTGAGGGCAAGCTCGACATTGCCGTG
TCGCCAGAGCTGCTGCCAACTAGCGTGGCTGTGACGCTGCACGTGCTGCAAAACATGCTCTTTTCCATTATCCGA
CTGCAGTTTTACCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail