Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4882
Gene name
LocationContig_343:2478..2907
Strand+
Gene length (bp)429
Transcript length (bp)273
Coding sequence length (bp)273
Protein length (aa) 91

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.9E-16 21 84

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2Q8|CFMB_ARTBC GPI-anchored CFEM domain protein ARB_02741 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02741 PE=1 SV=1 1 90 5.0E-10
sp|Q4WMA6|CFMB_ASPFU GPI-anchored CFEM domain protein B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cfmB PE=3 SV=1 1 90 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4882
MHLTAAIVAFCAIAVSAQDLGGLPECAKPCFIDNFPKSGCSNPNDYSCLCQSKNYIEAVTGCVVQKCQGTDLLDA
RQWAAEKCKAAGHPI*
Coding >OphauB2|4882
ATGCATCTTACCGCAGCCATCGTCGCTTTCTGTGCCATTGCAGTCTCAGCCCAGGATCTTGGTGGCCTTCCCGAA
TGCGCTAAGCCATGCTTCATTGATAACTTCCCCAAATCGGGGTGCAGCAACCCTAACGACTATAGCTGTCTCTGT
CAGTCCAAGAATTACATCGAGGCCGTCACTGGCTGCGTCGTCCAAAAATGCCAGGGAACAGACCTCCTCGACGCT
CGCCAATGGGCGGCTGAAAAGTGCAAGGCCGCTGGTCACCCTATCTAG
Transcript >OphauB2|4882
ATGCATCTTACCGCAGCCATCGTCGCTTTCTGTGCCATTGCAGTCTCAGCCCAGGATCTTGGTGGCCTTCCCGAA
TGCGCTAAGCCATGCTTCATTGATAACTTCCCCAAATCGGGGTGCAGCAACCCTAACGACTATAGCTGTCTCTGT
CAGTCCAAGAATTACATCGAGGCCGTCACTGGCTGCGTCGTCCAAAAATGCCAGGGAACAGACCTCCTCGACGCT
CGCCAATGGGCGGCTGAAAAGTGCAAGGCCGCTGGTCACCCTATCTAG
Gene >OphauB2|4882
ATGCATCTTACCGCAGCCATCGTCGCTTTCTGTGCCATTGCAGTCTCAGCCCAGGATCTTGGTGGCCTTCCCGAA
TGCGCTAAGCCATGCTTCATTGATAACTTCCCCAAATCGGGGTGCAGCAACCCTAACGACTATAGCTGTCTCTGT
CAGTATGTTTGCTCCCATTCGCCTCTCTGCTTTTTGGGCATAGTTTGGGCTCCGAGGTCGCGGTAAGTCCCTGGA
ACTATATTGACCATTCCTGCCAGGTCCAAGAATTACATCGAGGCCGTCACTGGCTGCGTCGTCCAAAAATGCCAG
GGAACAGACCTGTAAATTCCCACCCCATGGTCTTGAAGCTTTTCGAAAAGCAGACTAATCTTGTTTGACAGCCTC
GACGCTCGCCAATGGGCGGCTGAAAAGTGCAAGGCCGCTGGTCACCCTATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail