Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4866
Gene name
LocationContig_34:120588..122937
Strand-
Gene length (bp)2349
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08245 Mur_ligase_M Mur ligase middle domain 4.8E-07 53 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD0|FOLD_SCHPO Probable dihydrofolate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol3 PE=3 SV=1 31 441 6.0E-49
sp|Q12676|FOLD_YEAST Dihydrofolate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL3 PE=1 SV=1 31 442 2.0E-45
sp|Q05865|FOLC_BACSU Folylpolyglutamate synthase OS=Bacillus subtilis (strain 168) GN=folC PE=3 SV=2 31 439 2.0E-30
sp|P15925|FOLC_LACCA Folylpolyglutamate synthase OS=Lactobacillus casei GN=fgs PE=1 SV=1 28 435 2.0E-26
sp|P43775|FOLC_HAEIN Folylpolyglutamate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folC PE=3 SV=1 25 237 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD0|FOLD_SCHPO Probable dihydrofolate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol3 PE=3 SV=1 31 441 6.0E-49
sp|Q12676|FOLD_YEAST Dihydrofolate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL3 PE=1 SV=1 31 442 2.0E-45
sp|Q05865|FOLC_BACSU Folylpolyglutamate synthase OS=Bacillus subtilis (strain 168) GN=folC PE=3 SV=2 31 439 2.0E-30
sp|P15925|FOLC_LACCA Folylpolyglutamate synthase OS=Lactobacillus casei GN=fgs PE=1 SV=1 28 435 2.0E-26
sp|P43775|FOLC_HAEIN Folylpolyglutamate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folC PE=3 SV=1 25 237 2.0E-23
sp|Q54CY5|FOLC_DICDI Putative folylpolyglutamate synthase OS=Dictyostelium discoideum GN=folC PE=3 SV=1 51 248 2.0E-23
sp|Q8W035|FPGS3_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS3 PE=1 SV=1 49 307 5.0E-22
sp|Q05932|FOLC_HUMAN Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens GN=FPGS PE=1 SV=3 51 341 8.0E-22
sp|P48760|FOLC_MOUSE Folylpolyglutamate synthase, mitochondrial OS=Mus musculus GN=Fpgs PE=1 SV=3 33 243 2.0E-21
sp|F4JYE9|DHFS_ARATH Dihydrofolate synthetase OS=Arabidopsis thaliana GN=DHFS PE=1 SV=1 12 213 4.0E-21
sp|F4K2A1|FPGS1_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS1 PE=1 SV=1 51 313 2.0E-20
sp|Q924L9|FOLC_CRIGR Folylpolyglutamate synthase, mitochondrial OS=Cricetulus griseus GN=FPGS PE=2 SV=1 51 243 3.0E-20
sp|D4GW05|FOLCP_HALVD Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=folCP PE=3 SV=1 25 320 1.0E-19
sp|Q9Y893|FOLE_CANAX Folylpolyglutamate synthase OS=Candida albicans GN=MET7 PE=3 SV=1 5 379 2.0E-19
sp|A6H751|FOLC_BOVIN Folylpolyglutamate synthase, mitochondrial OS=Bos taurus GN=FPGS PE=2 SV=1 5 239 2.0E-19
sp|Q09509|FOLC_CAEEL Putative folylpolyglutamate synthase OS=Caenorhabditis elegans GN=F25B5.6 PE=3 SV=1 30 444 3.0E-19
sp|F4J2K2|FPGS2_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS2 PE=1 SV=1 44 244 4.0E-19
sp|P08192|FOLC_ECOLI Bifunctional protein FolC OS=Escherichia coli (strain K12) GN=folC PE=1 SV=2 26 213 5.0E-18
sp|Q8K9X3|FOLC_BUCAP Bifunctional protein FolC OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=folC PE=3 SV=1 53 321 6.0E-18
sp|Q89AT2|FOLC_BUCBP Bifunctional protein FolC OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=folC PE=3 SV=1 53 236 4.0E-17
sp|O13492|FOLE_NEUCR Folylpolyglutamate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-6 PE=1 SV=2 29 238 1.0E-14
sp|O74742|FOLE_SCHPO Probable folylpolyglutamate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met7 PE=2 SV=1 51 229 2.0E-14
sp|P57265|FOLC_BUCAI Bifunctional protein FolC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=folC PE=3 SV=1 53 320 2.0E-13
sp|E7KIA3|FOLE_YEASA Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain AWRI796) GN=MET7 PE=3 SV=2 51 440 4.0E-13
sp|B5VSC3|FOLE_YEAS6 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MET7 PE=3 SV=2 51 440 5.0E-13
sp|E7QKX4|FOLE_YEASZ Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=MET7 PE=3 SV=2 51 440 5.0E-13
sp|Q08645|FOLE_YEAST Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET7 PE=1 SV=1 51 440 5.0E-13
sp|E7KUJ4|FOLE_YEASL Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=MET7 PE=3 SV=2 51 440 5.0E-13
sp|C8ZGZ3|FOLE_YEAS8 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MET7 PE=3 SV=1 51 440 5.0E-13
sp|A6ZP80|FOLE_YEAS7 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain YJM789) GN=MET7 PE=3 SV=1 51 440 5.0E-13
sp|B3LJR0|FOLE_YEAS1 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MET7 PE=3 SV=1 51 440 5.0E-13
sp|E7NMM0|FOLE_YEASO Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain FostersO) GN=MET7 PE=3 SV=2 51 440 2.0E-12
sp|Q9HS44|FOLCP_HALSA Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=folP PE=3 SV=1 51 224 3.0E-12
sp|E7Q9C7|FOLE_YEASB Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain FostersB) GN=MET7 PE=3 SV=2 51 440 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0005524 ATP binding Yes
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4866
MPHPQDVKRALNRVRSAMPPGKRTELAHRKIRLGLERINRIVPRTQSWKGVHVAGTNGKGSICTLLAGMMRRCGI
SHGVFLSPAIPEPHNGILINGRYIHPHAYQDACRGVRESFERRSRSFLMVEGEEQEELTPFETETVAAFRLFENM
HVKYGIVEVGMGGATDATNAMVQKSVTIISRIDLDHQEYLGHTLEKIAAVKAGIMRKGVPCVVDSTNEESVLQVL
KTRAKKLGVRISLSESAEPFLPSCTRNQSSLQEYERHNFLCAVLAFKTLFPNLPLEPLKKMSGRASLPGRTESLA
VSAFSQGLRTKPILADGAHNLLGVRALKKYLKYKMRVQKEPVTWVLGFSYSETKPFPEMIEALIRPQDNVAFVEF
TTHSNDPSPTPAEFGLEVAEAIVKDKSQLYQGDPYISPALEWALQVAGEGPVVVTGSLYLVRDLLRLEGVVSNRK
IGTRPAGVNQIWRYQQLAKTRDLTPEEECDFKRARRHWISSPMNPNSKAVLRRPMTSEMKFRQTNMAFHKRQVES
YSAAIESMERDLAAGIKIEPPSTQEAVGERQQESDAGEMSEEKKQEKDVGEMDWNKQKTLEQTEKLDEKPVPDSR
AGDGKTEASQEKQALGGQNEAEAKDDETSVQSFLCTRIEEVKKLRDQHAAAYEKEVAQVRRSAKTSNKTHAMSHE
ALFGCSEPFELPARSISRKYRLDFEPPMTKAPPLLPEHKLPQFKGYEAKPEKKPHPEDMGAIEAAWAFGEGRNKR
QSERSKVPMVMKRHKDGSWHPKRNRHDELWKM*
Coding >OphauB2|4866
ATGCCTCACCCTCAAGACGTCAAGCGCGCGCTGAACCGCGTGCGGTCTGCCATGCCCCCGGGGAAGCGCACTGAA
TTAGCGCACCGCAAAATCCGCCTCGGCCTTGAACGCATCAACCGCATCGTGCCCCGGACGCAGTCGTGGAAGGGC
GTCCACGTTGCCGGCACCAATGGCAAGGGCAGCATCTGCACCTTGCTTGCCGGCATGATGCGCCGCTGTGGAATC
AGCCACGGCGTCTTTCTCTCGCCCGCCATTCCCGAGCCGCACAATGGCATCCTCATCAATGGCCGCTACATCCAT
CCCCACGCATATCAAGACGCCTGCCGCGGCGTTCGCGAGTCCTTTGAGCGCCGCTCCCGCTCCTTTCTCATGGTT
GAGGGCGAAGAACAGGAGGAGCTGACGCCCTTTGAAACCGAGACCGTGGCCGCCTTTCGTCTCTTTGAGAACATG
CACGTCAAGTACGGCATCGTCGAGGTGGGCATGGGCGGTGCGACGGATGCCACCAATGCCATGGTTCAAAAATCC
GTCACCATCATCTCGCGCATTGACCTCGACCATCAGGAATACCTCGGCCACACTCTGGAGAAAATTGCAGCCGTA
AAGGCTGGTATTATGCGTAAAGGCGTCCCCTGCGTCGTCGACTCTACCAATGAGGAATCTGTCCTCCAAGTCCTT
AAAACCCGTGCCAAGAAACTTGGCGTCCGGATTAGCCTTTCAGAAAGTGCTGAACCTTTTCTCCCTTCCTGCACG
CGCAACCAGTCCTCGCTCCAAGAGTATGAGCGCCACAATTTTTTGTGTGCTGTCCTCGCCTTTAAAACTCTCTTT
CCTAATCTGCCCTTGGAGCCACTCAAGAAGATGTCTGGCCGCGCATCTCTCCCAGGCAGGACAGAGTCGCTAGCT
GTTTCTGCCTTTTCTCAAGGGCTTCGCACCAAGCCAATTCTTGCAGACGGTGCGCACAATTTACTCGGCGTCAGG
GCTCTCAAAAAGTATCTTAAATACAAGATGCGAGTCCAAAAGGAGCCCGTCACCTGGGTCTTGGGCTTCTCATAC
AGCGAGACGAAACCATTTCCCGAAATGATCGAGGCTCTCATTCGACCGCAAGATAACGTGGCTTTTGTCGAGTTT
ACTACCCACTCCAACGACCCTTCTCCCACGCCTGCCGAGTTTGGGCTGGAAGTGGCAGAAGCTATAGTCAAGGAC
AAGTCGCAGCTCTATCAAGGCGATCCCTATATCAGCCCGGCCCTGGAATGGGCATTGCAAGTGGCCGGCGAGGGT
CCCGTTGTCGTGACTGGAAGCCTCTACCTGGTGCGTGATCTTTTGCGACTTGAGGGCGTCGTATCAAATCGCAAG
ATTGGCACCAGACCGGCTGGTGTAAATCAAATCTGGAGATATCAACAACTAGCCAAGACACGAGACTTGACTCCC
GAGGAAGAGTGCGATTTCAAACGCGCACGAAGACATTGGATCTCATCGCCCATGAATCCAAACAGCAAGGCAGTT
TTAAGGAGACCCATGACGTCTGAAATGAAGTTTCGGCAAACCAACATGGCGTTTCACAAAAGACAAGTAGAATCG
TACTCGGCTGCCATTGAGAGCATGGAGAGAGACTTGGCGGCGGGCATCAAAATCGAACCGCCCAGTACACAAGAG
GCAGTTGGCGAGAGGCAGCAAGAATCTGATGCAGGCGAGATGAGTGAGGAGAAGAAGCAAGAAAAAGATGTAGGT
GAGATGGATTGGAATAAACAAAAGACGTTGGAGCAAACGGAAAAGTTGGACGAGAAGCCTGTGCCGGACAGTCGA
GCAGGAGACGGCAAGACCGAGGCCAGCCAAGAAAAGCAGGCCCTTGGCGGCCAAAACGAGGCCGAGGCCAAGGAC
GACGAGACAAGCGTGCAAAGCTTTCTCTGCACGAGGATTGAAGAAGTAAAAAAACTGCGCGACCAACACGCCGCA
GCGTACGAAAAGGAAGTGGCCCAGGTTCGCCGCTCGGCCAAGACGTCAAACAAGACGCATGCCATGAGCCACGAA
GCCCTCTTTGGGTGCTCAGAGCCGTTCGAGTTGCCAGCCAGGTCCATATCGAGGAAATATCGCCTCGACTTTGAG
CCGCCGATGACGAAGGCTCCGCCGTTGCTACCAGAACACAAGCTGCCGCAGTTTAAGGGCTACGAGGCTAAACCA
GAAAAGAAGCCTCATCCAGAGGACATGGGCGCCATTGAAGCGGCGTGGGCATTTGGCGAAGGGAGGAACAAGCGT
CAGTCGGAAAGGTCCAAGGTTCCAATGGTCATGAAGAGGCACAAGGATGGGAGTTGGCATCCCAAACGGAATCGC
CACGATGAGTTGTGGAAAATGTAA
Transcript >OphauB2|4866
ATGCCTCACCCTCAAGACGTCAAGCGCGCGCTGAACCGCGTGCGGTCTGCCATGCCCCCGGGGAAGCGCACTGAA
TTAGCGCACCGCAAAATCCGCCTCGGCCTTGAACGCATCAACCGCATCGTGCCCCGGACGCAGTCGTGGAAGGGC
GTCCACGTTGCCGGCACCAATGGCAAGGGCAGCATCTGCACCTTGCTTGCCGGCATGATGCGCCGCTGTGGAATC
AGCCACGGCGTCTTTCTCTCGCCCGCCATTCCCGAGCCGCACAATGGCATCCTCATCAATGGCCGCTACATCCAT
CCCCACGCATATCAAGACGCCTGCCGCGGCGTTCGCGAGTCCTTTGAGCGCCGCTCCCGCTCCTTTCTCATGGTT
GAGGGCGAAGAACAGGAGGAGCTGACGCCCTTTGAAACCGAGACCGTGGCCGCCTTTCGTCTCTTTGAGAACATG
CACGTCAAGTACGGCATCGTCGAGGTGGGCATGGGCGGTGCGACGGATGCCACCAATGCCATGGTTCAAAAATCC
GTCACCATCATCTCGCGCATTGACCTCGACCATCAGGAATACCTCGGCCACACTCTGGAGAAAATTGCAGCCGTA
AAGGCTGGTATTATGCGTAAAGGCGTCCCCTGCGTCGTCGACTCTACCAATGAGGAATCTGTCCTCCAAGTCCTT
AAAACCCGTGCCAAGAAACTTGGCGTCCGGATTAGCCTTTCAGAAAGTGCTGAACCTTTTCTCCCTTCCTGCACG
CGCAACCAGTCCTCGCTCCAAGAGTATGAGCGCCACAATTTTTTGTGTGCTGTCCTCGCCTTTAAAACTCTCTTT
CCTAATCTGCCCTTGGAGCCACTCAAGAAGATGTCTGGCCGCGCATCTCTCCCAGGCAGGACAGAGTCGCTAGCT
GTTTCTGCCTTTTCTCAAGGGCTTCGCACCAAGCCAATTCTTGCAGACGGTGCGCACAATTTACTCGGCGTCAGG
GCTCTCAAAAAGTATCTTAAATACAAGATGCGAGTCCAAAAGGAGCCCGTCACCTGGGTCTTGGGCTTCTCATAC
AGCGAGACGAAACCATTTCCCGAAATGATCGAGGCTCTCATTCGACCGCAAGATAACGTGGCTTTTGTCGAGTTT
ACTACCCACTCCAACGACCCTTCTCCCACGCCTGCCGAGTTTGGGCTGGAAGTGGCAGAAGCTATAGTCAAGGAC
AAGTCGCAGCTCTATCAAGGCGATCCCTATATCAGCCCGGCCCTGGAATGGGCATTGCAAGTGGCCGGCGAGGGT
CCCGTTGTCGTGACTGGAAGCCTCTACCTGGTGCGTGATCTTTTGCGACTTGAGGGCGTCGTATCAAATCGCAAG
ATTGGCACCAGACCGGCTGGTGTAAATCAAATCTGGAGATATCAACAACTAGCCAAGACACGAGACTTGACTCCC
GAGGAAGAGTGCGATTTCAAACGCGCACGAAGACATTGGATCTCATCGCCCATGAATCCAAACAGCAAGGCAGTT
TTAAGGAGACCCATGACGTCTGAAATGAAGTTTCGGCAAACCAACATGGCGTTTCACAAAAGACAAGTAGAATCG
TACTCGGCTGCCATTGAGAGCATGGAGAGAGACTTGGCGGCGGGCATCAAAATCGAACCGCCCAGTACACAAGAG
GCAGTTGGCGAGAGGCAGCAAGAATCTGATGCAGGCGAGATGAGTGAGGAGAAGAAGCAAGAAAAAGATGTAGGT
GAGATGGATTGGAATAAACAAAAGACGTTGGAGCAAACGGAAAAGTTGGACGAGAAGCCTGTGCCGGACAGTCGA
GCAGGAGACGGCAAGACCGAGGCCAGCCAAGAAAAGCAGGCCCTTGGCGGCCAAAACGAGGCCGAGGCCAAGGAC
GACGAGACAAGCGTGCAAAGCTTTCTCTGCACGAGGATTGAAGAAGTAAAAAAACTGCGCGACCAACACGCCGCA
GCGTACGAAAAGGAAGTGGCCCAGGTTCGCCGCTCGGCCAAGACGTCAAACAAGACGCATGCCATGAGCCACGAA
GCCCTCTTTGGGTGCTCAGAGCCGTTCGAGTTGCCAGCCAGGTCCATATCGAGGAAATATCGCCTCGACTTTGAG
CCGCCGATGACGAAGGCTCCGCCGTTGCTACCAGAACACAAGCTGCCGCAGTTTAAGGGCTACGAGGCTAAACCA
GAAAAGAAGCCTCATCCAGAGGACATGGGCGCCATTGAAGCGGCGTGGGCATTTGGCGAAGGGAGGAACAAGCGT
CAGTCGGAAAGGTCCAAGGTTCCAATGGTCATGAAGAGGCACAAGGATGGGAGTTGGCATCCCAAACGGAATCGC
CACGATGAGTTGTGGAAAATGTAA
Gene >OphauB2|4866
ATGCCTCACCCTCAAGACGTCAAGCGCGCGCTGAACCGCGTGCGGTCTGCCATGCCCCCGGGGAAGCGCACTGAA
TTAGCGCACCGCAAAATCCGCCTCGGCCTTGAACGCATCAACCGCATCGTGCCCCGGACGCAGTCGTGGAAGGGC
GTCCACGTTGCCGGCACCAATGGCAAGGGCAGCATCTGCACCTTGCTTGCCGGCATGATGCGCCGCTGTGGAATC
AGCCACGGCGTCTTTCTCTCGCCCGCCATTCCCGAGCCGCACAATGGCATCCTCATCAATGGCCGCTACATCCAT
CCCCACGCATATCAAGACGCCTGCCGCGGCGTTCGCGAGTCCTTTGAGCGCCGCTCCCGCTCCTTTCTCATGGTT
GAGGGCGAAGAACAGGAGGAGCTGACGCCCTTTGAAACCGAGACCGTGGCCGCCTTTCGTCTCTTTGAGAACATG
CACGTCAAGTACGGCATCGTCGAGGTGGGCATGGGCGGTGCGACGGATGCCACCAATGCCATGGTTCAAAAATCC
GTCACCATCATCTCGCGCATTGACCTCGACCATCAGGAATACCTCGGCCACACTCTGGAGAAAATTGCAGCCGTA
AAGGCTGGTATTATGCGTAAAGGCGTCCCCTGCGTCGTCGACTCTACCAATGAGGAATCTGTCCTCCAAGTCCTT
AAAACCCGTGCCAAGAAACTTGGCGTCCGGATTAGCCTTTCAGAAAGTGCTGAACCTTTTCTCCCTTCCTGCACG
CGCAACCAGTCCTCGCTCCAAGAGTATGAGCGCCACAATTTTTTGTGTGCTGTCCTCGCCTTTAAAACTCTCTTT
CCTAATCTGCCCTTGGAGCCACTCAAGAAGATGTCTGGCCGCGCATCTCTCCCAGGCAGGACAGAGTCGCTAGCT
GTTTCTGCCTTTTCTCAAGGGCTTCGCACCAAGCCAATTCTTGCAGACGGTGCGCACAATTTACTCGGCGTCAGG
GCTCTCAAAAAGTATCTTAAATACAAGATGCGAGTCCAAAAGGAGCCCGTCACCTGGGTCTTGGGCTTCTCATAC
AGCGAGACGAAACCATTTCCCGAAATGATCGAGGCTCTCATTCGACCGCAAGATAACGTGGCTTTTGTCGAGTTT
ACTACCCACTCCAACGACCCTTCTCCCACGCCTGCCGAGTTTGGGCTGGAAGTGGCAGAAGCTATAGTCAAGGAC
AAGTCGCAGCTCTATCAAGGCGATCCCTATATCAGCCCGGCCCTGGAATGGGCATTGCAAGTGGCCGGCGAGGGT
CCCGTTGTCGTGACTGGAAGCCTCTACCTGGTGCGTGATCTTTTGCGACTTGAGGGCGTCGTATCAAATCGCAAG
ATTGGCACCAGACCGGCTGGTGTAAATCAAATCTGGAGATATCAACAACTAGCCAAGACACGAGACTTGACTCCC
GAGGAAGAGTGCGATTTCAAACGCGCACGAAGACATTGGATCTCATCGCCCATGAATCCAAACAGCAAGGCAGTT
TTAAGGAGACCCATGACGTCTGAAATGAAGTTTCGGCAAACCAACATGGCGTTTCACAAAAGACAAGTAGAATCG
TACTCGGCTGCCATTGAGAGCATGGAGAGAGACTTGGCGGCGGGCATCAAAATCGAACCGCCCAGTACACAAGAG
GCAGTTGGCGAGAGGCAGCAAGAATCTGATGCAGGCGAGATGAGTGAGGAGAAGAAGCAAGAAAAAGATGTAGGT
GAGATGGATTGGAATAAACAAAAGACGTTGGAGCAAACGGAAAAGTTGGACGAGAAGCCTGTGCCGGACAGTCGA
GCAGGAGACGGCAAGACCGAGGCCAGCCAAGAAAAGCAGGCCCTTGGCGGCCAAAACGAGGCCGAGGCCAAGGAC
GACGAGACAAGCGTGCAAAGCTTTCTCTGCACGAGGATTGAAGAAGTAAAAAAACTGCGCGACCAACACGCCGCA
GCGTACGAAAAGGAAGTGGCCCAGGTTCGCCGCTCGGCCAAGACGTCAAACAAGACGCATGCCATGAGCCACGAA
GCCCTCTTTGGGTGCTCAGAGCCGTTCGAGTTGCCAGCCAGGTCCATATCGAGGAAATATCGCCTCGACTTTGAG
CCGCCGATGACGAAGGCTCCGCCGTTGCTACCAGAACACAAGCTGCCGCAGTTTAAGGGCTACGAGGCTAAACCA
GAAAAGAAGCCTCATCCAGAGGACATGGGCGCCATTGAAGCGGCGTGGGCATTTGGCGAAGGGAGGAACAAGCGT
CAGTCGGAAAGGTCCAAGGTTCCAATGGTCATGAAGAGGCACAAGGATGGGAGTTGGCATCCCAAACGGAATCGC
CACGATGAGTTGTGGAAAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail