Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4865
Gene name
LocationContig_34:119508..120334
Strand-
Gene length (bp)826
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02698 DUF218 DUF218 domain 3.8E-07 42 153

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87055|YDJ7_SCHPO Uncharacterized protein C57A10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A10.07 PE=4 SV=1 4 206 5.0E-37
sp|Q08634|YO238_YEAST Uncharacterized protein YOR238W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR238W PE=1 SV=2 6 217 2.0E-23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4865
MAPTHLVVVCCHGIWTGGASRGADEAEWLIAPFQRGETDTFIAHARAGIELLAQDPDDSVVVFSGGPTRKETRQS
EASSYALVAQANQYWDLLQDATRSILLEERALDSYHNVLFSLTLFYTRFSRWPETMTLVGHGFKRARLEAHVTAL
GFPGDRVRYIGLDPPGIEAGSEVLQGVKEAEEEWREDVHGRGERLAGKRRARNPWRVWQGVFVEGSGDAGGLVTR
RQGHEEMLDEAAARPW*
Coding >OphauB2|4865
ATGGCGCCTACGCACCTTGTAGTTGTTTGCTGCCACGGCATTTGGACCGGAGGCGCCTCGCGGGGCGCGGATGAA
GCAGAGTGGCTTATTGCGCCCTTTCAGCGCGGCGAAACAGACACCTTTATAGCCCACGCGCGAGCCGGCATTGAG
CTCTTGGCGCAGGATCCGGACGACAGCGTCGTCGTATTTTCGGGAGGTCCGACGCGCAAGGAGACGCGGCAGTCT
GAAGCAAGTAGCTACGCCCTCGTTGCACAAGCAAACCAGTACTGGGACCTGCTCCAAGACGCGACGCGCAGCATT
TTGCTAGAGGAGCGCGCACTCGACTCATACCACAATGTGCTTTTTAGCCTAACTCTCTTTTACACGCGCTTCTCG
CGCTGGCCAGAGACAATGACGCTTGTGGGGCATGGATTCAAGCGAGCGCGGCTCGAGGCGCATGTCACTGCGCTG
GGGTTTCCGGGGGACCGCGTGCGGTATATTGGATTGGATCCGCCGGGCATAGAGGCGGGGAGCGAGGTGCTGCAA
GGGGTAAAGGAGGCGGAGGAGGAGTGGCGGGAGGATGTGCATGGACGGGGGGAGCGGTTGGCGGGGAAGCGGAGG
GCGAGGAATCCATGGAGGGTGTGGCAGGGAGTGTTTGTGGAAGGAAGTGGTGATGCGGGTGGTTTGGTGACGAGG
AGACAAGGCCATGAGGAAATGCTGGATGAAGCTGCGGCGCGGCCGTGGTGA
Transcript >OphauB2|4865
ATGGCGCCTACGCACCTTGTAGTTGTTTGCTGCCACGGCATTTGGACCGGAGGCGCCTCGCGGGGCGCGGATGAA
GCAGAGTGGCTTATTGCGCCCTTTCAGCGCGGCGAAACAGACACCTTTATAGCCCACGCGCGAGCCGGCATTGAG
CTCTTGGCGCAGGATCCGGACGACAGCGTCGTCGTATTTTCGGGAGGTCCGACGCGCAAGGAGACGCGGCAGTCT
GAAGCAAGTAGCTACGCCCTCGTTGCACAAGCAAACCAGTACTGGGACCTGCTCCAAGACGCGACGCGCAGCATT
TTGCTAGAGGAGCGCGCACTCGACTCATACCACAATGTGCTTTTTAGCCTAACTCTCTTTTACACGCGCTTCTCG
CGCTGGCCAGAGACAATGACGCTTGTGGGGCATGGATTCAAGCGAGCGCGGCTCGAGGCGCATGTCACTGCGCTG
GGGTTTCCGGGGGACCGCGTGCGGTATATTGGATTGGATCCGCCGGGCATAGAGGCGGGGAGCGAGGTGCTGCAA
GGGGTAAAGGAGGCGGAGGAGGAGTGGCGGGAGGATGTGCATGGACGGGGGGAGCGGTTGGCGGGGAAGCGGAGG
GCGAGGAATCCATGGAGGGTGTGGCAGGGAGTGTTTGTGGAAGGAAGTGGTGATGCGGGTGGTTTGGTGACGAGG
AGACAAGGCCATGAGGAAATGCTGGATGAAGCTGCGGCGCGGCCGTGGTGA
Gene >OphauB2|4865
ATGGCGCCTACGCACCTTGTAGTTGTTTGCTGCCACGGCATTTGGACCGGAGGCGCCTCGCGGGGCGCGGATGAA
GCAGAGTGGCTTATTGCGCCCTTTCAGCGCGGCGAAACAGACACCTTTATAGCCCACGCGCGAGCCGGCATTGAG
CTCTTGGCGCAGGATCCGGACGACAGCGTCGTCGTATTTTCGGGGTAAGGTGAATTCTTTATTTATCCCGTGCCG
CAATGGGCCTTGTCAAAGACGCTAAGCATTCATGACATGCATATATGTGTGTATCGTGTATATAAACAGAGGTCC
GACGCGCAAGGAGACGCGGCAGTCTGAAGCAAGTAGCTACGCCCTCGTTGCACAAGCAAACCAGTACTGGGACCT
GCTCCAAGACGCGACGCGCAGCATTTTGCTAGAGGAGCGCGCACTCGACTCATACCACAATGTGCTTTTTAGCCT
AACTCTCTTTTACACGCGCTTCTCGCGCTGGCCAGAGACAATGACGCTTGTGGGGCATGGATTCAAGCGAGCGCG
GCTCGAGGCGCATGTCACTGCGCTGGGGTTTCCGGGGGACCGCGTGCGGTATATTGGATTGGATCCGCCGGGCAT
AGAGGCGGGGAGCGAGGTGCTGCAAGGGGTAAAGGAGGCGGAGGAGGAGTGGCGGGAGGATGTGCATGGACGGGG
GGAGCGGTTGGCGGGGAAGCGGAGGGCGAGGAATCCATGGAGGGTGTGGCAGGGAGTGTTTGTGGAAGGAAGTGG
TGATGCGGGTGGTTTGGTGACGAGGAGACAAGGCCATGAGGAAATGCTGGATGAAGCTGCGGCGCGGCCGTGGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail