Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4863
Gene name
LocationContig_34:116264..117653
Strand+
Gene length (bp)1389
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08426 ICE2 ICE2 1.9E-150 7 421

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13909|YDW1_SCHPO Uncharacterized protein C23C11.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C11.01 PE=4 SV=1 13 433 2.0E-55
sp|P40499|ICE2_YEAST Protein ICE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICE2 PE=1 SV=1 13 420 7.0E-31

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 33 55 22
3 67 89 22
4 138 155 17
5 175 197 22
6 207 226 19
7 233 250 17
8 303 325 22
9 359 381 22
10 401 423 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4863
MWWIISILFSFVFLCSIVLSIPVAFDVGGRDSGLAYSLSLFIYYMLYSAICIVTLETTRLGRAVSALLRLSQWLV
IPVLMIWALSQFAVDAGSSTSWVERTLGSIWHSKNTSWTEWVFGRDGVLETLMLGSWDNSLRYAGPVFQLLEGFC
TLLVIQATGQITRWLVNRGRSDTWVIVFLAFSGSIIASAVYFLWRVAQFPQISNLDATLIGITMTTAVFLCAYGI
GSGRGSPVEGSLLFAYVVLCVYQIFTDYLPSDGMGQAESGSLVQPQLPPLPPIIMASYSTLVHILASLPLAMRSS
LTFLYAAFQTITPSVIISLAYRLFVFYSATRIIPSVRDLGVRAMMEEPDFEDSETANKLLGILSWFSPSILVAVY
TSLLLQHFSTNDGPDGWSLRGGDVGGGTWRWINVGLTMGLYGVELYLSRDGQEHWKVD*
Coding >OphauB2|4863
ATGTGGTGGATAATAAGCATTCTCTTCAGCTTCGTCTTTCTCTGCAGCATCGTTCTCTCCATCCCCGTTGCCTTT
GATGTCGGGGGCCGCGACAGTGGGCTGGCTTATAGCCTCTCGCTCTTCATCTACTACATGTTGTACTCGGCCATT
TGCATAGTAACGCTCGAAACGACGCGCCTCGGCCGGGCAGTCTCTGCTTTGCTCCGTCTGTCGCAATGGCTCGTT
ATTCCTGTCCTCATGATTTGGGCGCTGAGCCAATTCGCTGTTGACGCTGGCAGCTCGACAAGCTGGGTGGAGAGG
ACGCTCGGCAGCATCTGGCACTCGAAAAACACGAGCTGGACCGAATGGGTCTTTGGCCGAGACGGCGTCCTCGAG
ACGCTGATGCTGGGCAGCTGGGACAATAGCTTGAGATATGCCGGCCCCGTCTTTCAGCTGCTCGAGGGCTTTTGC
ACCTTGTTGGTGATTCAAGCCACGGGACAAATAACACGCTGGCTCGTCAATAGGGGACGCAGCGATACCTGGGTG
ATTGTCTTTCTCGCCTTTTCAGGGTCCATTATTGCCAGCGCCGTTTACTTTTTGTGGCGCGTCGCCCAGTTTCCT
CAAATCAGCAACCTGGACGCCACTCTGATTGGCATCACCATGACGACGGCCGTCTTTCTCTGCGCGTACGGAATC
GGCAGCGGCCGTGGCAGCCCAGTCGAGGGCTCGCTGCTGTTTGCCTATGTTGTTCTCTGTGTCTACCAAATCTTT
ACCGACTACCTGCCCTCGGACGGCATGGGCCAGGCCGAGAGCGGGAGCCTGGTTCAGCCACAGCTGCCACCCCTA
CCGCCGATAATCATGGCGTCGTACTCGACCCTGGTGCATATACTTGCGTCACTACCGCTGGCGATGCGATCCTCC
CTCACCTTTCTCTACGCTGCGTTTCAAACCATTACGCCTTCAGTCATTATATCGCTCGCATATCGTCTCTTTGTC
TTTTACTCTGCTACACGCATAATCCCATCAGTACGCGATCTCGGAGTGCGCGCCATGATGGAGGAGCCCGACTTT
GAGGACTCGGAAACGGCCAATAAGCTGTTGGGCATCCTGAGCTGGTTCTCGCCATCTATTCTTGTAGCCGTGTAT
ACCAGTCTCTTATTACAACACTTTTCCACCAATGACGGGCCTGATGGCTGGTCGCTGCGAGGCGGCGACGTTGGT
GGCGGCACTTGGCGCTGGATCAATGTCGGACTGACCATGGGTCTGTACGGGGTCGAGCTCTACCTGAGCAGAGAC
GGCCAGGAGCACTGGAAGGTGGACTAA
Transcript >OphauB2|4863
ATGTGGTGGATAATAAGCATTCTCTTCAGCTTCGTCTTTCTCTGCAGCATCGTTCTCTCCATCCCCGTTGCCTTT
GATGTCGGGGGCCGCGACAGTGGGCTGGCTTATAGCCTCTCGCTCTTCATCTACTACATGTTGTACTCGGCCATT
TGCATAGTAACGCTCGAAACGACGCGCCTCGGCCGGGCAGTCTCTGCTTTGCTCCGTCTGTCGCAATGGCTCGTT
ATTCCTGTCCTCATGATTTGGGCGCTGAGCCAATTCGCTGTTGACGCTGGCAGCTCGACAAGCTGGGTGGAGAGG
ACGCTCGGCAGCATCTGGCACTCGAAAAACACGAGCTGGACCGAATGGGTCTTTGGCCGAGACGGCGTCCTCGAG
ACGCTGATGCTGGGCAGCTGGGACAATAGCTTGAGATATGCCGGCCCCGTCTTTCAGCTGCTCGAGGGCTTTTGC
ACCTTGTTGGTGATTCAAGCCACGGGACAAATAACACGCTGGCTCGTCAATAGGGGACGCAGCGATACCTGGGTG
ATTGTCTTTCTCGCCTTTTCAGGGTCCATTATTGCCAGCGCCGTTTACTTTTTGTGGCGCGTCGCCCAGTTTCCT
CAAATCAGCAACCTGGACGCCACTCTGATTGGCATCACCATGACGACGGCCGTCTTTCTCTGCGCGTACGGAATC
GGCAGCGGCCGTGGCAGCCCAGTCGAGGGCTCGCTGCTGTTTGCCTATGTTGTTCTCTGTGTCTACCAAATCTTT
ACCGACTACCTGCCCTCGGACGGCATGGGCCAGGCCGAGAGCGGGAGCCTGGTTCAGCCACAGCTGCCACCCCTA
CCGCCGATAATCATGGCGTCGTACTCGACCCTGGTGCATATACTTGCGTCACTACCGCTGGCGATGCGATCCTCC
CTCACCTTTCTCTACGCTGCGTTTCAAACCATTACGCCTTCAGTCATTATATCGCTCGCATATCGTCTCTTTGTC
TTTTACTCTGCTACACGCATAATCCCATCAGTACGCGATCTCGGAGTGCGCGCCATGATGGAGGAGCCCGACTTT
GAGGACTCGGAAACGGCCAATAAGCTGTTGGGCATCCTGAGCTGGTTCTCGCCATCTATTCTTGTAGCCGTGTAT
ACCAGTCTCTTATTACAACACTTTTCCACCAATGACGGGCCTGATGGCTGGTCGCTGCGAGGCGGCGACGTTGGT
GGCGGCACTTGGCGCTGGATCAATGTCGGACTGACCATGGGTCTGTACGGGGTCGAGCTCTACCTGAGCAGAGAC
GGCCAGGAGCACTGGAAGGTGGACTAA
Gene >OphauB2|4863
ATGTGGTGGATAATAAGCATTCTCTTCAGCTTCGTCTTTCTCTGCAGCATCGTTCTCTCCATCCCCGTTGCCTTT
GATGTCGGGGGCCGCGACAGTGGGCTGGCTTATAGCCTCTCGCTCTTCATCTACTACATGTTGTACTCGGCCATT
TGCATAGTAACGCTCGAAACGACGCGCCTCGGCCGGGCAGTCTCTGCTTTGCTCCGTCTGTCGCAATGGCTCGTT
ATTCCTGTCCTCATGATTTGGGCGCTGAGCCAATTCGCTGTTGACGCTGGCAGCTCGACAAGCTGGGTGGAGAGG
ACGCTCGGCAGCATCTGGCACTCGAAAAACACGAGCTGGACCGAATGGGTCTTTGGCCGAGACGGCGTCCTCGAG
ACGCTGATGCTGGGCAGCTGGGACAATAGCTTGAGATATGCCGGCCCCGTCTTTCAGCTGCTCGAGGGCTTTTGC
ACCTTGTTGGTGATTCAAGCCACGGGACAAATAACACGCTGGCTCGTCAATAGGGGACGCAGCGATACCTGGGTG
GTATGTCAAAGAAAACAAGACCAAAAAAAAAAAACCGTTGCGCGAATAGCGTCTTGCCAGGCGGCCGACTTACCC
TGTCCTGTCTAGATTGTCTTTCTCGCCTTTTCAGGGTCCATTATTGCCAGCGCCGTTTACTTTTTGTGGCGCGTC
GCCCAGTTTCCTCAAATCAGCAACCTGGACGCCACTCTGATTGGCATCACCATGACGACGGCCGTCTTTCTCTGC
GCGTACGGAATCGGCAGCGGCCGTGGCAGCCCAGTCGAGGGCTCGCTGCTGTTTGCCTATGTTGTTCTCTGTGTC
TACCAAATCTTTACCGACTACCTGCCCTCGGACGGCATGGGCCAGGCCGAGAGCGGGAGCCTGGTTCAGCCACAG
CTGCCACCCCTACCGCCGATAATCATGGCGTCGTACTCGACCCTGGTGCATATACTTGCGTCACTACCGCTGGCG
ATGCGATCCTCCCTCACCTTTCTCTACGCTGCGTTTCAAACCATTACGCCTTCAGTCATTATATCGCTCGCATAT
CGTCTCTTTGTCTTTTACTCTGCTACACGCATAATCCCATCAGTACGCGATCTCGGAGTGCGCGCCATGATGGAG
GAGCCCGACTTTGAGGACTCGGAAACGGCCAATAAGCTGTTGGGCATCCTGAGCTGGTTCTCGCCATCTATTCTT
GTAGCCGTGTATACCAGTCTCTTATTACAACACTTTTCCACCAATGACGGGCCTGATGGCTGGTCGCTGCGAGGC
GGCGACGTTGGTGGCGGCACTTGGCGCTGGATCAATGTCGGACTGACCATGGGTCTGTACGGGGTCGAGCTCTAC
CTGAGCAGAGACGGCCAGGAGCACTGGAAGGTGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail