Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4862
Gene name
LocationContig_34:111751..113532
Strand-
Gene length (bp)1781
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 7.6E-25 111 510

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 75 537 8.0E-59

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 119 141 22
2 146 168 22
3 189 211 22
4 226 247 21
5 254 276 22
6 307 329 22
7 341 363 22
8 387 409 22
9 421 443 22
10 453 475 22
11 496 518 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4862
MASSINKAGSVYNSPSASIAIDHDVEGGIGDKDKKQTSRLVDSSSPPRRFASIFGGKGVRVGPRIAPLPEWLKTD
ATVASPSDDDEAAVTSEDILNRQLASEDGASIQYRTCSWQKTAALLFSEYICLAIMSFPWSYSFLGLVPGLILTV
VIAGIVLYTSLVLWEFCLRHPEVRDVCDLGQMLFWGKPWAWWGTAAMFVLNNTFIQGLHVLVGAEYLNTMTAGSK
VAGCRSVEFAVVVTVICWIASLPRTFSMLSKLGTASAFFTFISVILATVFAGTQGKPAGYNSSLGEPIVTAFPAS
TTNFVKGMAAFLNISYTFIGQITLPSFIAEMRDPREFPKSLWACTIAEILTFSIVGAVMYAYTGNQYMTTPAFGS
LHDLYKKISFSFMIPTIIFLGCLYASVTSRFVFFRLFRNSRHLNDHTVIGWGSWAAILLATWIMAFIISQVIPFF
SSLLSVMSSLFDSWFGFIFWGVAYFRMRRADQEIGRRRRPLLDYMSMAFNIVIILTGIFFLTVGTYASVQGIIDA
FADGTVRGVFSCGTNGV*
Coding >OphauB2|4862
ATGGCTTCTTCCATCAACAAGGCTGGCTCAGTCTACAACTCGCCCTCGGCCTCGATTGCCATTGACCACGATGTC
GAGGGGGGCATTGGCGACAAGGACAAGAAGCAAACGTCACGACTAGTCGATTCGTCATCGCCGCCTCGGCGGTTT
GCCTCCATTTTTGGCGGCAAGGGTGTCCGTGTCGGTCCCCGCATTGCTCCCTTGCCAGAGTGGCTCAAGACGGAT
GCCACGGTTGCATCGCCCTCGGATGACGATGAGGCAGCCGTGACGAGCGAGGACATTCTTAACCGCCAGCTTGCG
TCGGAGGATGGCGCCTCGATTCAGTATCGCACGTGCAGCTGGCAAAAGACGGCTGCCCTGCTCTTTAGCGAATAT
ATTTGCCTGGCCATTATGAGCTTTCCCTGGTCATACAGCTTTCTCGGCCTCGTCCCCGGCCTCATCCTCACCGTG
GTTATTGCCGGCATTGTGCTCTACACCAGCCTCGTCCTTTGGGAGTTTTGTCTGCGCCATCCCGAGGTGCGCGAT
GTCTGTGACTTGGGGCAAATGCTCTTTTGGGGCAAGCCTTGGGCCTGGTGGGGGACCGCTGCCATGTTTGTCCTC
AACAACACCTTTATCCAAGGCCTCCACGTCTTGGTTGGCGCAGAATATCTCAACACCATGACGGCCGGCTCCAAG
GTGGCTGGCTGCCGCTCAGTCGAGTTTGCCGTTGTCGTCACCGTCATTTGCTGGATTGCTTCCCTGCCGCGCACC
TTTAGCATGCTTTCCAAGCTGGGAACAGCCTCGGCCTTCTTCACCTTTATTTCCGTCATTCTCGCCACCGTCTTT
GCCGGCACCCAGGGAAAGCCGGCCGGCTACAACAGCTCGCTTGGAGAGCCCATTGTCACAGCCTTTCCCGCCTCC
ACCACAAACTTTGTCAAGGGCATGGCGGCCTTTCTCAACATTAGCTACACCTTTATCGGCCAGATTACCCTGCCC
AGTTTTATTGCTGAGATGCGAGATCCACGAGAATTCCCAAAGTCGCTTTGGGCATGCACCATTGCCGAGATTCTC
ACCTTTAGCATCGTTGGTGCCGTCATGTACGCCTACACGGGCAATCAGTACATGACGACGCCCGCATTCGGCTCC
TTGCACGACTTGTACAAGAAGATATCCTTCTCCTTCATGATACCCACCATTATCTTCTTGGGCTGCCTCTACGCC
TCGGTCACGTCACGCTTCGTCTTTTTCCGCCTCTTTCGCAACTCGCGTCACCTCAACGACCACACAGTCATTGGA
TGGGGCTCATGGGCCGCCATCTTGCTCGCTACCTGGATCATGGCTTTCATCATTTCCCAAGTCATTCCCTTTTTT
TCATCGCTCTTGTCCGTCATGTCATCGCTCTTTGACAGCTGGTTCGGCTTCATCTTCTGGGGCGTGGCCTACTTT
CGCATGCGACGTGCCGACCAAGAAATCGGCCGCCGCCGCCGCCCGCTTCTCGACTACATGTCAATGGCATTCAAC
ATTGTCATTATCCTGACGGGCATATTCTTCCTCACCGTCGGCACGTATGCCAGCGTGCAAGGCATCATTGACGCT
TTTGCCGACGGCACTGTTCGGGGGGTGTTTTCGTGCGGCACTAACGGCGTTTGA
Transcript >OphauB2|4862
ATGGCTTCTTCCATCAACAAGGCTGGCTCAGTCTACAACTCGCCCTCGGCCTCGATTGCCATTGACCACGATGTC
GAGGGGGGCATTGGCGACAAGGACAAGAAGCAAACGTCACGACTAGTCGATTCGTCATCGCCGCCTCGGCGGTTT
GCCTCCATTTTTGGCGGCAAGGGTGTCCGTGTCGGTCCCCGCATTGCTCCCTTGCCAGAGTGGCTCAAGACGGAT
GCCACGGTTGCATCGCCCTCGGATGACGATGAGGCAGCCGTGACGAGCGAGGACATTCTTAACCGCCAGCTTGCG
TCGGAGGATGGCGCCTCGATTCAGTATCGCACGTGCAGCTGGCAAAAGACGGCTGCCCTGCTCTTTAGCGAATAT
ATTTGCCTGGCCATTATGAGCTTTCCCTGGTCATACAGCTTTCTCGGCCTCGTCCCCGGCCTCATCCTCACCGTG
GTTATTGCCGGCATTGTGCTCTACACCAGCCTCGTCCTTTGGGAGTTTTGTCTGCGCCATCCCGAGGTGCGCGAT
GTCTGTGACTTGGGGCAAATGCTCTTTTGGGGCAAGCCTTGGGCCTGGTGGGGGACCGCTGCCATGTTTGTCCTC
AACAACACCTTTATCCAAGGCCTCCACGTCTTGGTTGGCGCAGAATATCTCAACACCATGACGGCCGGCTCCAAG
GTGGCTGGCTGCCGCTCAGTCGAGTTTGCCGTTGTCGTCACCGTCATTTGCTGGATTGCTTCCCTGCCGCGCACC
TTTAGCATGCTTTCCAAGCTGGGAACAGCCTCGGCCTTCTTCACCTTTATTTCCGTCATTCTCGCCACCGTCTTT
GCCGGCACCCAGGGAAAGCCGGCCGGCTACAACAGCTCGCTTGGAGAGCCCATTGTCACAGCCTTTCCCGCCTCC
ACCACAAACTTTGTCAAGGGCATGGCGGCCTTTCTCAACATTAGCTACACCTTTATCGGCCAGATTACCCTGCCC
AGTTTTATTGCTGAGATGCGAGATCCACGAGAATTCCCAAAGTCGCTTTGGGCATGCACCATTGCCGAGATTCTC
ACCTTTAGCATCGTTGGTGCCGTCATGTACGCCTACACGGGCAATCAGTACATGACGACGCCCGCATTCGGCTCC
TTGCACGACTTGTACAAGAAGATATCCTTCTCCTTCATGATACCCACCATTATCTTCTTGGGCTGCCTCTACGCC
TCGGTCACGTCACGCTTCGTCTTTTTCCGCCTCTTTCGCAACTCGCGTCACCTCAACGACCACACAGTCATTGGA
TGGGGCTCATGGGCCGCCATCTTGCTCGCTACCTGGATCATGGCTTTCATCATTTCCCAAGTCATTCCCTTTTTT
TCATCGCTCTTGTCCGTCATGTCATCGCTCTTTGACAGCTGGTTCGGCTTCATCTTCTGGGGCGTGGCCTACTTT
CGCATGCGACGTGCCGACCAAGAAATCGGCCGCCGCCGCCGCCCGCTTCTCGACTACATGTCAATGGCATTCAAC
ATTGTCATTATCCTGACGGGCATATTCTTCCTCACCGTCGGCACGTATGCCAGCGTGCAAGGCATCATTGACGCT
TTTGCCGACGGCACTGTTCGGGGGGTGTTTTCGTGCGGCACTAACGGCGTTTGA
Gene >OphauB2|4862
ATGGCTTCTTCCATCAACAAGGCTGGCTCAGTCTACAACTCGCCCTCGGCCTCGATTGCCATTGACCACGATGTC
GAGGGGGGCATTGGCGACAAGGACAAGAAGCAAACGTCACGACTAGTCGATTCGTCATCGCCGCCTCGGCGGTTT
GCCTCCATTTTTGGCGGCAAGGGTGTCCGTGTCGGTCCCCGCATTGCTCCCTTGCCAGAGTGGCTCAAGACGGAT
GCCACGGTTGCATCGCCCTCGGATGACGATGAGGCAGCCGTGACGAGCGAGGACATTCTTAACCGCCAGCTTGCG
TCGGAGGATGGCGCCTCGATTCAGTATCGCACGTGCAGCTGGCAAAAGACGGCTGCCCTGCTCTTTAGCGAATAT
ATTTGCCTGGCCATTATGAGCTTTCCCTGGTCATACAGCTTTCTCGGCCTCGTCCCCGGCCTCATCCTCACCGTG
GTTATTGCCGGCATTGTGCTCTACACCAGCCTCGTCCTTTGGGAGTTTTGTCTGCGCCATCCCGAGGTGCGCGAT
GTCTGTGACTTGGGGCAAATGCTCTTTTGGGGCAAGCCTTGGGCCTGGTGGGGGACCGCTGCCATGTTTGTCCTC
AACAACACCTTTATCCAAGGCCTCCACGTCTTGGTTGGCGCAGAATATCTCAACACCATGACGGCCGGCTCCAAG
GTGGCTGGCTGCCGCTCAGTCGAGTTTGCCGTTGTCGTCACCGTCATTTGCTGGATTGCTTCCCTGCCGCGCACC
TTTAGCATGCTTTCCAAGCTGGGAACAGCCTCGGCCTTCTTCACCTTTATTTCCGTCATTCTCGCCACCGTCTTT
GCCGGCACCCAGGGAAAGCCGGCCGGCTACAACAGCTCGCTTGGAGAGCCCATTGTCACAGCCTTTCCCGCCTCC
ACCACAAACTTTGTCAAGGGCATGGCGGCCTTTCTCAACATTAGCTACACCTTTATCGGCCAGATTACCCTGCCC
AGTTTTATTGCTGAGATGCGAGATCCACGGTAACCCCTGACCGTACCGGCTCAAGGTCCCTTTTCCCGCCAATGA
TGATTCTGACTTGTGTGTGTGTGTGTGACAGAGAATTCCCAAAGTCGCTTTGGGCATGCACCATTGCCGAGATTC
TCACCTTTAGCATCGTTGGTGCCGTCATGTACGCCTACACGGGCAATCAGTACATGACGACGCCCGCATTCGGCT
CCTTGCACGACTTGTACAAGAAGATATCCTTCTCCTTCATGATACCCACCATTATCTTCTTGGGCTGCCTCTACG
CCTCGGTCACGTCACGCTTCGTCTTTTTCCGCCTCTTTCGCAACTCGCGTCACCTCAACGACCACACAGTCATTG
GATGGGGCTCATGGGCCGCCATCTTGCTCGCTACCTGGATCATGGCTTTCATCATTTCCCAAGTCATTCCCTTTT
TTTCATCGCGTGAGTACATTACCCTCAATGTAAACCAAGGTGGTGGCGAGAGGAGAATCGTGGCTTACACAAACG
CTTGAAAAGTCTTGTCCGTCATGTCATCGCTCTTTGACAGCTGGTTCGGCTTCATCTTCTGGGGCGTGGCCTACT
TTCGCATGCGACGTGCCGACCAAGAAATCGGCCGCCGCCGCCGCCCGCTTCTCGACTACATGTCAATGGCATTCA
ACATTGTCATTATCCTGACGGGCATATTCTTCCTCACCGTCGGCACGTATGCCAGCGTGCAAGGCATCATTGACG
CTTTTGCCGACGGCACTGTTCGGGGGGTGTTTTCGTGCGGCACTAACGGCGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail