Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4860
Gene name
LocationContig_34:107479..108721
Strand+
Gene length (bp)1242
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00635 Motile_Sperm MSP (Major sperm protein) domain 1.0E-24 3 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10484|YDFC_SCHPO Uncharacterized protein C17C9.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.12 PE=1 SV=2 10 121 2.0E-27
sp|O60119|YH75_SCHPO Vesicle-associated membrane protein-associated protein C16G5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.05c PE=1 SV=1 9 121 3.0E-23
sp|B9DHD7|VAP22_ARATH Vesicle-associated protein 2-2 OS=Arabidopsis thaliana GN=PVA22 PE=1 SV=1 3 123 5.0E-23
sp|Q84WW5|VAP13_ARATH Vesicle-associated protein 1-3 OS=Arabidopsis thaliana GN=PVA13 PE=2 SV=1 3 124 2.0E-20
sp|P40075|SCS2_YEAST Vesicle-associated membrane protein-associated protein SCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS2 PE=1 SV=3 2 122 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10484|YDFC_SCHPO Uncharacterized protein C17C9.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.12 PE=1 SV=2 10 121 2.0E-27
sp|O60119|YH75_SCHPO Vesicle-associated membrane protein-associated protein C16G5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.05c PE=1 SV=1 9 121 3.0E-23
sp|B9DHD7|VAP22_ARATH Vesicle-associated protein 2-2 OS=Arabidopsis thaliana GN=PVA22 PE=1 SV=1 3 123 5.0E-23
sp|Q84WW5|VAP13_ARATH Vesicle-associated protein 1-3 OS=Arabidopsis thaliana GN=PVA13 PE=2 SV=1 3 124 2.0E-20
sp|P40075|SCS2_YEAST Vesicle-associated membrane protein-associated protein SCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS2 PE=1 SV=3 2 122 6.0E-20
sp|Q8VZ95|VAP11_ARATH Vesicle-associated protein 1-1 OS=Arabidopsis thaliana GN=PVA11 PE=1 SV=1 5 122 4.0E-19
sp|Q9Z269|VAPB_RAT Vesicle-associated membrane protein-associated protein B OS=Rattus norvegicus GN=Vapb PE=1 SV=3 9 128 2.0E-18
sp|Q9QY76|VAPB_MOUSE Vesicle-associated membrane protein-associated protein B OS=Mus musculus GN=Vapb PE=1 SV=3 9 128 6.0E-18
sp|Q0VCY1|VAPA_BOVIN Vesicle-associated membrane protein-associated protein A OS=Bos taurus GN=VAPA PE=2 SV=1 7 121 7.0E-18
sp|Q5R601|VAPA_PONAB Vesicle-associated membrane protein-associated protein A OS=Pongo abelii GN=VAPA PE=2 SV=2 7 128 7.0E-18
sp|Q9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-associated protein A OS=Homo sapiens GN=VAPA PE=1 SV=3 7 128 7.0E-18
sp|Q9Z270|VAPA_RAT Vesicle-associated membrane protein-associated protein A OS=Rattus norvegicus GN=Vapa PE=1 SV=3 7 121 1.0E-17
sp|Q9WV55|VAPA_MOUSE Vesicle-associated membrane protein-associated protein A OS=Mus musculus GN=Vapa PE=1 SV=2 7 128 1.0E-17
sp|A2VDZ9|VAPB_BOVIN Vesicle-associated membrane protein-associated protein B OS=Bos taurus GN=VAPB PE=2 SV=1 9 128 2.0E-17
sp|A5GFS8|VAPB_PIG Vesicle-associated membrane protein-associated protein B OS=Sus scrofa GN=VAPB PE=3 SV=1 9 88 3.0E-17
sp|O95292|VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens GN=VAPB PE=1 SV=3 9 88 3.0E-17
sp|Q9SHC8|VAP12_ARATH Vesicle-associated protein 1-2 OS=Arabidopsis thaliana GN=PVA12 PE=1 SV=1 5 169 8.0E-17
sp|Q16943|VP33_APLCA Vesicle-associated membrane protein/synaptobrevin-binding protein OS=Aplysia californica PE=2 SV=1 9 88 1.0E-16
sp|Q9LVU1|VAP21_ARATH Vesicle-associated protein 2-1 OS=Arabidopsis thaliana GN=PVA21 PE=1 SV=1 3 122 2.0E-14
sp|O82213|VAP31_ARATH Vesicle-associated protein 3-1 OS=Arabidopsis thaliana GN=PVA31 PE=3 SV=1 3 124 5.0E-13
sp|Q9SYC9|VAP14_ARATH Vesicle-associated protein 1-4 OS=Arabidopsis thaliana GN=PVA14 PE=2 SV=1 5 122 1.0E-11
sp|Q6Q595|SCS22_YEAST Vesicle-associated membrane protein-associated protein SCS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS22 PE=1 SV=2 5 140 3.0E-10
sp|Q9SYC9|VAP14_ARATH Vesicle-associated protein 1-4 OS=Arabidopsis thaliana GN=PVA14 PE=2 SV=1 3 96 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 269 288 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4860
MSVDVEPLELSFRRPFTEEVSQTLTIKNTTSSPLAFKVKTTAPKQYCVRPNAGRIEPGQDFDVTVLLQAMKSDPP
LETKCRDKFLVQSAPITAEKEFVPIASVLEKADKGQIQERKIRVSWLPSAGAKDQVSAVPQSGNSTPMKQSIVTA
VDETPNAARHYATPRARADSTPRGSIDPSSHTPDSKHDDDKSERPRSAVSQAATAVSDSAQTTYEELKAKLAQTE
AQLANYRDSGLRQRGAKTAAVGDESKSSTTKTAPQPSLKQAEGVSVQLVAILCLMSFLLAYFFF*
Coding >OphauB2|4860
ATGTCTGTCGATGTCGAGCCCCTCGAGTTGTCCTTCCGACGCCCTTTTACCGAGGAAGTATCCCAGACTCTGACC
ATCAAGAATACGACGTCGTCGCCGCTTGCATTCAAGGTGAAAACGACTGCGCCGAAACAATACTGCGTGCGGCCA
AATGCAGGCCGTATCGAGCCGGGTCAGGACTTTGACGTCACGGTCCTCTTGCAAGCAATGAAGTCGGATCCCCCG
CTCGAAACAAAATGCCGCGACAAGTTTCTAGTGCAATCCGCCCCAATTACAGCCGAAAAGGAGTTTGTCCCAATT
GCATCAGTTCTTGAAAAAGCCGACAAGGGCCAGATTCAAGAGCGCAAGATCCGGGTCAGCTGGCTGCCTTCAGCT
GGAGCCAAAGACCAGGTCAGCGCTGTCCCTCAGTCTGGAAACTCGACGCCTATGAAACAATCCATCGTCACTGCC
GTTGACGAAACACCCAACGCGGCGCGCCACTATGCAACTCCACGTGCACGAGCAGACTCGACTCCCCGAGGCTCC
ATCGACCCCTCTTCACACACGCCCGACTCCAAACACGATGACGACAAGTCGGAGCGCCCTAGGTCGGCCGTGTCT
CAAGCTGCTACTGCCGTGTCGGACTCTGCTCAAACTACTTACGAAGAGCTCAAGGCAAAGCTTGCCCAAACCGAG
GCCCAGCTCGCCAACTATAGAGACAGTGGACTGCGCCAGCGCGGCGCAAAGACGGCAGCCGTTGGCGACGAAAGC
AAGAGCTCCACCACCAAGACTGCGCCCCAGCCATCGCTCAAGCAGGCCGAGGGTGTTTCAGTGCAGCTAGTCGCC
ATTCTGTGCTTGATGAGCTTTCTCTTGGCATACTTCTTTTTTTAA
Transcript >OphauB2|4860
ATGTCTGTCGATGTCGAGCCCCTCGAGTTGTCCTTCCGACGCCCTTTTACCGAGGAAGTATCCCAGACTCTGACC
ATCAAGAATACGACGTCGTCGCCGCTTGCATTCAAGGTGAAAACGACTGCGCCGAAACAATACTGCGTGCGGCCA
AATGCAGGCCGTATCGAGCCGGGTCAGGACTTTGACGTCACGGTCCTCTTGCAAGCAATGAAGTCGGATCCCCCG
CTCGAAACAAAATGCCGCGACAAGTTTCTAGTGCAATCCGCCCCAATTACAGCCGAAAAGGAGTTTGTCCCAATT
GCATCAGTTCTTGAAAAAGCCGACAAGGGCCAGATTCAAGAGCGCAAGATCCGGGTCAGCTGGCTGCCTTCAGCT
GGAGCCAAAGACCAGGTCAGCGCTGTCCCTCAGTCTGGAAACTCGACGCCTATGAAACAATCCATCGTCACTGCC
GTTGACGAAACACCCAACGCGGCGCGCCACTATGCAACTCCACGTGCACGAGCAGACTCGACTCCCCGAGGCTCC
ATCGACCCCTCTTCACACACGCCCGACTCCAAACACGATGACGACAAGTCGGAGCGCCCTAGGTCGGCCGTGTCT
CAAGCTGCTACTGCCGTGTCGGACTCTGCTCAAACTACTTACGAAGAGCTCAAGGCAAAGCTTGCCCAAACCGAG
GCCCAGCTCGCCAACTATAGAGACAGTGGACTGCGCCAGCGCGGCGCAAAGACGGCAGCCGTTGGCGACGAAAGC
AAGAGCTCCACCACCAAGACTGCGCCCCAGCCATCGCTCAAGCAGGCCGAGGGTGTTTCAGTGCAGCTAGTCGCC
ATTCTGTGCTTGATGAGCTTTCTCTTGGCATACTTCTTTTTTTAA
Gene >OphauB2|4860
ATGTCTGTCGATGTCGAGCCCCTCGAGTTGTCCTTCCGACGTACGTTGCCCGAGACACGCCGTGCTCTGGCAGCA
CAAACACTAACGGCATTGGCGCAGGCCCTTTTACCGAGGAAGTATCCCAGACTCTGACCATCAAGAATACGACGT
CGTCGCCGCTTGCATTCAAGGTCAGCGCGCCCTCTGAGTAGCTGCAAATTTCGGATCCTGTCATTGTTGTTCTAA
CGCTGCCTACAGGTGAAAACGACTGCGCCGAAACAGTTTGTCCCCCCAATCTCCCTGCTCCTGCTATATTCTCAT
GGTCTCGCCATTGCAGATACTGCGTGCGGCCAAATGCAGGCCGTATCGAGCCGGGTCAGGACTTTGACGTCACGG
GTGCGTCGTCTCTTGTCCCAATATCTCTTCTGCACTCACACTGCGATAGTCCTCTTGCAAGCAATGAAGTCGGAT
CCCCCGCTCGAAACAAAATGCCGCGACAAGTTTCTAGTGCAATCCGCCCCAATTACAGCCGAAAAGGAGTTTGTC
CCAATTGCATCAGTTGTGAGCTTTTCACCATGGGCGCTTACGAGTTTACTATGCTGACAATGGCTTATTTTGTTT
TTTTTCGCACTTGCAGCTTGAAAAAGCCGACAAGGGCCAGATTCAAGAGCGCAAGATCCGGGTCAGCTGGCTGCC
TTCAGCTGGAGCCAAAGACCAGGTCAGCGCTGTCCCTCAGTCTGGAAACTCGACGCCTATGAAACAATCCATCGT
CACTGCCGTGAGCGAAATATTCACTTTGTGACTTTTGAGCCTTTAAAGTGCTGACACGATTTGCAAAACCAGGTT
GACGAAACACCCAACGCGGCGCGCCACTATGCAACTCCACGTGCACGAGCAGACTCGACTCCCCGAGGCTCCATC
GACCCCTCTTCACACACGCCCGACTCCAAACACGATGACGACAAGTCGGAGCGCCCTAGGTCGGCCGTGTCTCAA
GCTGCTACTGCCGTGTCGGACTCTGCTCAAACTACTTACGAAGAGCTCAAGGCAAAGCTTGCCCAAACCGAGGCC
CAGCTCGCCAACTATAGAGACAGTGGACTGCGCCAGCGCGGCGCAAAGACGGCAGCCGTTGGCGACGAAAGCAAG
AGCTCCACCACCAAGACTGCGCCCCAGCCATCGCTCAAGCAGGCCGAGGGTGTTTCAGTGCAGCTAGTCGCCATT
CTGTGCTTGATGAGCTTTCTCTTGGCATACTTCTTTTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail