Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4859
Gene name
LocationContig_34:105445..106609
Strand-
Gene length (bp)1164
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 7.0E-06 4 35
PF00789 UBX UBX domain 2.4E-04 241 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10483|YDFB_SCHPO Uncharacterized protein C17C9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.11c PE=4 SV=2 77 315 2.0E-21
sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 3 316 5.0E-21
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 5 316 5.0E-19
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 5 316 5.0E-18
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 5 316 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10483|YDFB_SCHPO Uncharacterized protein C17C9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.11c PE=4 SV=2 77 315 2.0E-21
sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 3 316 5.0E-21
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 5 316 5.0E-19
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 5 316 5.0E-18
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 5 316 2.0E-17
sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 3 316 3.0E-12
sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=3 SV=2 3 316 7.0E-12
sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens GN=UBXN1 PE=1 SV=2 3 316 7.0E-09
sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 3 316 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3965
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5742
Ophiocordyceps australis map64 (Brazil) OphauB2|4859 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06869
Ophiocordyceps camponoti-rufipedis Ophun1|4743
Ophiocordyceps kimflemingae Ophio5|921
Ophiocordyceps subramaniannii Hirsu2|7905

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4859
MPTDLEQLLDMGFEEARAELACKQTGGLQGALQWLENNQDKSLEDIQAAQADDNDDNDEAETRAKIEELETGNAR
SLVCNDCGKRFRNSSLASYHASKTDHTDFSESTEEIAPLTEEEKKLKLVELRERLQAKKAAQSVQDKEDQKRNEK
IRQKSTKESQDLKEELQRKEQIQEAARKRQEKLEDIEAKKRIKARIEADKIERRRKADEAKALREGRAPASAAAT
ASSQSAPQAAPRPKADHNEARLRLQTSTGNITKTLPAETTLFELAQQIESETGIAVSSLSTTFPKHTFEGDIDMS
KTLKEAGLVPSSVLIVK*
Coding >OphauB2|4859
ATGCCCACCGATCTAGAGCAATTGCTCGACATGGGCTTTGAAGAAGCCCGTGCTGAGTTGGCTTGCAAGCAGACT
GGCGGACTTCAAGGCGCGCTGCAATGGCTCGAAAATAATCAAGACAAGTCCCTGGAGGATATCCAAGCAGCACAA
GCAGACGACAATGACGACAATGACGAAGCCGAGACTAGAGCAAAGATTGAAGAGCTTGAAACAGGCAACGCTCGC
TCCCTCGTTTGCAACGACTGCGGCAAGCGTTTTCGCAACTCTTCTCTAGCGAGCTACCATGCCTCCAAGACCGAC
CACACCGACTTTTCTGAGTCGACCGAAGAAATCGCCCCGCTCACTGAAGAAGAAAAGAAGCTCAAGCTCGTAGAA
CTGCGAGAGCGGCTGCAGGCTAAAAAGGCAGCCCAGTCTGTTCAAGACAAGGAGGACCAAAAACGTAACGAGAAA
ATTCGTCAGAAATCAACAAAGGAAAGCCAGGATTTAAAGGAAGAACTGCAGCGCAAGGAACAAATTCAAGAGGCA
GCTCGCAAGCGACAAGAAAAACTCGAAGATATCGAAGCCAAGAAGCGTATCAAGGCTCGAATCGAAGCTGACAAG
ATTGAGCGTCGTCGCAAGGCTGACGAAGCCAAAGCCCTGCGCGAGGGTCGAGCTCCCGCGTCGGCTGCAGCTACT
GCTTCCTCCCAGTCTGCCCCGCAAGCTGCTCCTCGGCCCAAGGCAGATCACAATGAAGCTCGCCTGCGGTTACAG
ACATCAACAGGTAACATTACCAAGACATTGCCCGCAGAAACAACTCTATTCGAACTAGCTCAGCAGATTGAGAGC
GAGACTGGCATAGCTGTGTCAAGCCTCTCTACGACTTTTCCAAAGCATACTTTTGAGGGAGACATTGACATGTCC
AAGACTTTAAAGGAGGCCGGGCTGGTACCCTCTTCGGTGCTCATTGTCAAGTGA
Transcript >OphauB2|4859
ATGCCCACCGATCTAGAGCAATTGCTCGACATGGGCTTTGAAGAAGCCCGTGCTGAGTTGGCTTGCAAGCAGACT
GGCGGACTTCAAGGCGCGCTGCAATGGCTCGAAAATAATCAAGACAAGTCCCTGGAGGATATCCAAGCAGCACAA
GCAGACGACAATGACGACAATGACGAAGCCGAGACTAGAGCAAAGATTGAAGAGCTTGAAACAGGCAACGCTCGC
TCCCTCGTTTGCAACGACTGCGGCAAGCGTTTTCGCAACTCTTCTCTAGCGAGCTACCATGCCTCCAAGACCGAC
CACACCGACTTTTCTGAGTCGACCGAAGAAATCGCCCCGCTCACTGAAGAAGAAAAGAAGCTCAAGCTCGTAGAA
CTGCGAGAGCGGCTGCAGGCTAAAAAGGCAGCCCAGTCTGTTCAAGACAAGGAGGACCAAAAACGTAACGAGAAA
ATTCGTCAGAAATCAACAAAGGAAAGCCAGGATTTAAAGGAAGAACTGCAGCGCAAGGAACAAATTCAAGAGGCA
GCTCGCAAGCGACAAGAAAAACTCGAAGATATCGAAGCCAAGAAGCGTATCAAGGCTCGAATCGAAGCTGACAAG
ATTGAGCGTCGTCGCAAGGCTGACGAAGCCAAAGCCCTGCGCGAGGGTCGAGCTCCCGCGTCGGCTGCAGCTACT
GCTTCCTCCCAGTCTGCCCCGCAAGCTGCTCCTCGGCCCAAGGCAGATCACAATGAAGCTCGCCTGCGGTTACAG
ACATCAACAGGTAACATTACCAAGACATTGCCCGCAGAAACAACTCTATTCGAACTAGCTCAGCAGATTGAGAGC
GAGACTGGCATAGCTGTGTCAAGCCTCTCTACGACTTTTCCAAAGCATACTTTTGAGGGAGACATTGACATGTCC
AAGACTTTAAAGGAGGCCGGGCTGGTACCCTCTTCGGTGCTCATTGTCAAGTGA
Gene >OphauB2|4859
ATGCCCACCGATCTAGAGCAATTGCTCGACATGGGCTTTGAAGAAGCCCGTGCTGAGTTGGCTTGCAAGCAGACT
GGCGGACGTGAGTCCTCGACCCTTTTTTTGTTATTGATGCGCATTCAAGTTGATGCGTCTTGCTATCTAGTTCAA
GGCGCGCTGCAATGGCTCGAAAATAATCAAGACAAGTCCCTGGAGGATATCCAAGCAGCACAAGCAGACGACAAT
GACGACAATGACGAAGCCGAGACTAGAGCAAAGATTGAAGAGCTTGAAACAGGCAACGCTCGCTCCCTCGTTTGC
AACGACTGCGGCAAGCGTTTTCGCAACTCTTCTCTAGCGAGCTACCATGCCTCCAAGACGTGAGCGGGCGGAGAA
AACCATGATTTACGAAATGACATGGCTGACAAACATGGTGTTGCAGCGACCACACCGACTTTTCTGAGTCGACCG
AAGAAATCGCCCCGCTCACTGAAGAAGAAAAGAAGCTCAAGCTCGTAGAACTGCGAGAGCGGCTGCAGGCTAAAA
AGGCAGCCCAGTCTGTTCAAGACAAGGAGGACCAAAAACGTAACGAGGTATGACGTTCTGTCAGGCCTCCTCTAT
TGCGCCATTCCCGTCACCACTACGCACCACAAGGTTCAAGCTTACATGGCGTGGCAGAAAATTCGTCAGAAATCA
ACAAAGGAAAGCCAGGATTTAAAGGAAGAACTGCAGCGCAAGGAACAAATTCAAGAGGCAGCTCGCAAGCGACAA
GAAAAACTCGAAGATATCGAAGCCAAGAAGCGTATCAAGGCTCGAATCGAAGCTGACAAGATTGAGCGTCGTCGC
AAGGCTGACGAAGCCAAAGCCCTGCGCGAGGGTCGAGCTCCCGCGTCGGCTGCAGCTACTGCTTCCTCCCAGTCT
GCCCCGCAAGCTGCTCCTCGGCCCAAGGCAGATCACAATGAAGCTCGCCTGCGGTTACAGACATCAACAGGTAAC
ATTACCAAGACATTGCCCGCAGAAACAACTCTATTCGAACTAGCTCAGCAGATTGAGAGCGAGACTGGCATAGCT
GTGTCAAGCCTCTCTACGACTTTTCCAAAGCATACTTTTGAGGGAGACATTGACATGTCCAAGACTTTAAAGGAG
GCCGGGCTGGTACCCTCTTCGGTGCTCATTGTCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail