Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4856
Gene name
LocationContig_34:99926..101478
Strand+
Gene length (bp)1552
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.6E-27 5 391
PF00083 Sugar_tr Sugar (and other) transporter 3.3E-05 12 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 1 440 2.0E-46
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 10 433 2.0E-40
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 22 373 7.0E-14
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 4 371 1.0E-12
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 224 416 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 1 440 2.0E-46
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 10 433 2.0E-40
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 22 373 7.0E-14
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 4 371 1.0E-12
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 224 416 7.0E-12
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 17 353 1.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 217 413 4.0E-10
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 8 432 9.0E-10
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 1 131 3.0E-08
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 15 441 5.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 22 368 9.0E-08
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 16 442 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 41 60 19
3 128 150 22
4 232 254 22
5 269 291 22
6 311 333 22
7 338 357 19
8 364 386 22
9 406 428 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup21
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|781
Ophiocordyceps australis 1348a (Ghana) OphauG2|3621
Ophiocordyceps australis map64 (Brazil) OphauB2|135
Ophiocordyceps australis map64 (Brazil) OphauB2|4856 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05528
Ophiocordyceps camponoti-floridani Ophcf2|03539
Ophiocordyceps camponoti-floridani Ophcf2|02729
Ophiocordyceps camponoti-floridani Ophcf2|00664
Ophiocordyceps camponoti-rufipedis Ophun1|3781
Ophiocordyceps camponoti-rufipedis Ophun1|1856
Ophiocordyceps camponoti-rufipedis Ophun1|435
Ophiocordyceps camponoti-rufipedis Ophun1|607
Ophiocordyceps kimflemingae Ophio5|4168
Ophiocordyceps kimflemingae Ophio5|4169
Ophiocordyceps kimflemingae Ophio5|5392
Ophiocordyceps kimflemingae Ophio5|6880
Ophiocordyceps kimflemingae Ophio5|741
Ophiocordyceps subramaniannii Hirsu2|7470
Ophiocordyceps subramaniannii Hirsu2|7469
Ophiocordyceps subramaniannii Hirsu2|7335
Ophiocordyceps subramaniannii Hirsu2|6881
Ophiocordyceps subramaniannii Hirsu2|6880
Ophiocordyceps subramaniannii Hirsu2|5938
Ophiocordyceps subramaniannii Hirsu2|1965
Ophiocordyceps subramaniannii Hirsu2|9409
Ophiocordyceps subramaniannii Hirsu2|10936

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4856
MIVDLKTDTETLSNASAVQLAGLAIGCMFFIPFAEKYGRRSAYIISTLLVTISTWWSAYMKTGTEVYLTNALMGL
AGAVNEAAIQMSIRDMFYIHQRATANGVYFASVKAGTYLTPMAAGAQAVSTGWRSSYITLAGFMTGLTLLFLVAF
EETKFIPPKVADIRLNESSTSGLHIDSKEAIDPETSSIQETAVMETLPPFPRYLRLQFFTKTGESLWKLFWSPFH
AWWLPQVIFVIFQSGAAVCWLVLIGITTSIVFSKEPYNFNSAQLGYMSAGAFIGSICGSLYGGPFVDWAIVRLAR
RNKGLFEPEMRLYLMPVPSLLMCIGLLVFGITADRGMHWIFPVIGNGLFAFGFGSVADITFTMVIDCYPNLVAII
FTVIATGRNALSMIGPFSITPWLKRSSVSNVFIIAAFINLGIHLFAIPLAIWGKKSRVAMAPRYYRLSKECA*
Coding >OphauB2|4856
ATGATTGTAGATTTGAAGACGGACACGGAAACTCTTTCCAATGCAAGCGCAGTGCAGCTAGCTGGCCTAGCAATC
GGCTGCATGTTCTTTATCCCCTTTGCAGAAAAGTACGGCAGACGATCCGCCTATATTATTTCCACGTTACTCGTC
ACCATCTCGACATGGTGGTCTGCCTACATGAAGACGGGGACAGAGGTTTACCTCACCAATGCCCTCATGGGTCTA
GCCGGTGCCGTCAACGAGGCAGCCATCCAAATGAGCATTCGCGACATGTTTTATATCCATCAACGAGCCACGGCA
AATGGAGTCTACTTTGCCTCGGTCAAGGCAGGCACCTATCTCACCCCCATGGCCGCAGGCGCACAGGCAGTTAGC
ACGGGCTGGCGATCGTCTTACATTACGCTTGCCGGCTTCATGACGGGCCTCACCCTCCTCTTCCTCGTGGCCTTT
GAAGAGACCAAGTTTATCCCGCCCAAGGTCGCCGACATCCGTCTAAACGAGTCGAGCACTTCCGGCTTGCATATC
GACTCGAAAGAAGCCATTGATCCTGAAACTTCGAGCATCCAGGAAACCGCAGTCATGGAAACGCTTCCTCCTTTT
CCGCGCTACCTTCGTCTGCAATTCTTCACCAAGACTGGCGAGTCGCTCTGGAAGCTCTTTTGGTCCCCTTTTCAC
GCCTGGTGGCTCCCTCAAGTCATCTTCGTCATTTTCCAATCGGGTGCAGCCGTCTGCTGGCTCGTCTTGATTGGC
ATCACAACGTCCATCGTCTTTTCCAAGGAGCCATACAACTTTAACTCGGCGCAGCTTGGCTATATGTCTGCCGGA
GCCTTTATTGGATCCATTTGTGGCAGTCTTTACGGTGGCCCCTTTGTTGATTGGGCCATTGTAAGGCTCGCAAGA
CGAAACAAGGGACTCTTTGAGCCGGAAATGCGCCTCTATCTCATGCCGGTGCCATCCTTGCTAATGTGCATTGGT
CTGCTCGTTTTCGGCATTACCGCCGATCGCGGTATGCATTGGATTTTTCCCGTTATTGGAAACGGCTTGTTTGCA
TTTGGTTTCGGTTCTGTTGCAGACATTACCTTTACCATGGTCATTGACTGCTATCCCAACCTTGTTGCCATCATC
TTCACCGTCATTGCTACTGGCCGCAACGCTCTCAGCATGATTGGCCCCTTTTCCATCACGCCATGGCTCAAGCGC
TCAAGCGTCAGCAACGTCTTCATCATTGCTGCCTTTATCAATCTCGGCATTCATCTATTTGCCATTCCACTTGCA
ATTTGGGGCAAAAAGTCCAGAGTTGCCATGGCGCCTCGTTATTATCGCTTGTCCAAGGAATGCGCCTAA
Transcript >OphauB2|4856
ATGATTGTAGATTTGAAGACGGACACGGAAACTCTTTCCAATGCAAGCGCAGTGCAGCTAGCTGGCCTAGCAATC
GGCTGCATGTTCTTTATCCCCTTTGCAGAAAAGTACGGCAGACGATCCGCCTATATTATTTCCACGTTACTCGTC
ACCATCTCGACATGGTGGTCTGCCTACATGAAGACGGGGACAGAGGTTTACCTCACCAATGCCCTCATGGGTCTA
GCCGGTGCCGTCAACGAGGCAGCCATCCAAATGAGCATTCGCGACATGTTTTATATCCATCAACGAGCCACGGCA
AATGGAGTCTACTTTGCCTCGGTCAAGGCAGGCACCTATCTCACCCCCATGGCCGCAGGCGCACAGGCAGTTAGC
ACGGGCTGGCGATCGTCTTACATTACGCTTGCCGGCTTCATGACGGGCCTCACCCTCCTCTTCCTCGTGGCCTTT
GAAGAGACCAAGTTTATCCCGCCCAAGGTCGCCGACATCCGTCTAAACGAGTCGAGCACTTCCGGCTTGCATATC
GACTCGAAAGAAGCCATTGATCCTGAAACTTCGAGCATCCAGGAAACCGCAGTCATGGAAACGCTTCCTCCTTTT
CCGCGCTACCTTCGTCTGCAATTCTTCACCAAGACTGGCGAGTCGCTCTGGAAGCTCTTTTGGTCCCCTTTTCAC
GCCTGGTGGCTCCCTCAAGTCATCTTCGTCATTTTCCAATCGGGTGCAGCCGTCTGCTGGCTCGTCTTGATTGGC
ATCACAACGTCCATCGTCTTTTCCAAGGAGCCATACAACTTTAACTCGGCGCAGCTTGGCTATATGTCTGCCGGA
GCCTTTATTGGATCCATTTGTGGCAGTCTTTACGGTGGCCCCTTTGTTGATTGGGCCATTGTAAGGCTCGCAAGA
CGAAACAAGGGACTCTTTGAGCCGGAAATGCGCCTCTATCTCATGCCGGTGCCATCCTTGCTAATGTGCATTGGT
CTGCTCGTTTTCGGCATTACCGCCGATCGCGGTATGCATTGGATTTTTCCCGTTATTGGAAACGGCTTGTTTGCA
TTTGGTTTCGGTTCTGTTGCAGACATTACCTTTACCATGGTCATTGACTGCTATCCCAACCTTGTTGCCATCATC
TTCACCGTCATTGCTACTGGCCGCAACGCTCTCAGCATGATTGGCCCCTTTTCCATCACGCCATGGCTCAAGCGC
TCAAGCGTCAGCAACGTCTTCATCATTGCTGCCTTTATCAATCTCGGCATTCATCTATTTGCCATTCCACTTGCA
ATTTGGGGCAAAAAGTCCAGAGTTGCCATGGCGCCTCGTTATTATCGCTTGTCCAAGGAATGCGCCTAA
Gene >OphauB2|4856
ATGATTGTAGATTTGAAGACGGACACGGAAACTCTTTCCAATGCAAGCGCAGTGCAGCTAGCTGGCCTAGCAATC
GGCTGCATGTTCTTTATCCCCTTTGCAGAAAAGTACGGCAGACGATCCGCCTATATTATTTCCACGTTACTCGTC
ACCATCTCGACATGGTGGTCTGCCTACATGAAGACGGGGACAGAGGTTTACCTCACCAATGCCCTCATGGGTCTA
GCCGGTGCCGTCAACGAGGCAGCCATCCAAATGAGCGTATGTTGTGTAATTCTTTATGTCTATATCCTTGGCATT
GCCCCTTGTATAAAAAACCGCCCAGCAAGATGCTTCAAGCTAACCGCCACCAACATCAGATTCGCGACATGTTTT
ATATCCATCAACGAGCCACGGCAAATGGAGTCTACTTTGCCTCGGTCAAGGCAGGCACCTATCTCACCCCCATGG
CCGCAGGCGCACAGGCAGTTAGCACGGGCTGGCGATCGTCTTACATTACGCTTGCCGGCTTCATGACGGGCCTCA
CCCTCCTCTTCCTCGTGGCCTTTGAAGAGACCAAGTTTATCCCGCCCAAGGTCGCCGACATCCGTCTAAACGAGT
CGAGCACTTCCGGCTTGCATATCGACTCGAAAGAAGCCATTGATCCTGAAACTTCGAGCATCCAGGAAACCGCAG
TCATGGAAACGCTTCCTCCTTTTCCGCGCTACCTTCGTCTGCAATTCTTCACCAAGACTGGCGAGTCGCTCTGGA
AGCTCTTTTGGTCCCCTTTTCACGCCTGGTGGCTCCCTCAAGTCATCTTCGTCATTTTCCAATCGGGTGCAGCCG
TCTGCTGGCTCGTCTTGATTGGCATCACAACGTCCATCGTCTTTTCCAAGGAGCCATACAACTTTAACTCGGCGC
AGCTTGGCTATATGTCTGCCGGAGCCTTTATTGGATCCATTTGTGGCAGTCTTTACGGTGGCCCCTTTGTTGATT
GGGCCATTGTAAGGCTCGCAAGACGAAACAAGGGACTCTTTGAGCCGGAAATGCGCCTCTATCTCATGCCGGTGC
CATCCTTGCTAATGTGCATTGGTCTGCTCGTTTTCGGCATTACCGCCGATCGCGTACGCGTCTCCTATTTCCCTC
CTTGGTGCCCGTCTCGTCTAACAGATCCTCTAGGGTATGCATTGGATTTTTCCCGTTATTGGAAACGGCTTGTTT
GCATTTGGTTTCGGTTCTGTTGCAGACATTACCTTTACCATGGTCATTGACTGCTATCCCAACGTGAGTTATTCC
CCTCCCCACAAATGCTTAGAATATAATACTCATTTCCTACAAGCTTGTTGCCATCATCTTCACCGTCATTGCTAC
TGGCCGCAACGCTCTCAGCATGATTGGCCCCTTTTCCATCACGCCATGGCTCAAGCGCTCAAGCGTCAGCAACGT
CTTCATCATTGCTGCCTTTATCAATCTCGGCATTCATCTATTTGCCATTCCACTTGCAATTTGGGGCAAAAAGTC
CAGAGTTGCCATGGCGCCTCGTTATTATCGCTTGTCCAAGGAATGCGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail