Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4842
Gene name
LocationContig_34:59816..61944
Strand-
Gene length (bp)2128
Transcript length (bp)1935
Coding sequence length (bp)1935
Protein length (aa) 645

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04065 Not3 Not1 N-terminal domain, CCR4-Not complex component 4.4E-88 3 231
PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family 3.9E-42 512 640

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13870|NOT3_SCHPO General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not3 PE=1 SV=2 1 232 2.0E-81
sp|P06102|NOT3_YEAST General negative regulator of transcription subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOT3 PE=1 SV=2 1 351 3.0E-65
sp|Q8K0V4|CNOT3_MOUSE CCR4-NOT transcription complex subunit 3 OS=Mus musculus GN=Cnot3 PE=1 SV=1 4 232 3.0E-64
sp|O75175|CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens GN=CNOT3 PE=1 SV=1 4 232 1.0E-63
sp|Q12514|NOT5_YEAST General negative regulator of transcription subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOT5 PE=1 SV=1 1 231 4.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13870|NOT3_SCHPO General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not3 PE=1 SV=2 1 232 2.0E-81
sp|P06102|NOT3_YEAST General negative regulator of transcription subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOT3 PE=1 SV=2 1 351 3.0E-65
sp|Q8K0V4|CNOT3_MOUSE CCR4-NOT transcription complex subunit 3 OS=Mus musculus GN=Cnot3 PE=1 SV=1 4 232 3.0E-64
sp|O75175|CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens GN=CNOT3 PE=1 SV=1 4 232 1.0E-63
sp|Q12514|NOT5_YEAST General negative regulator of transcription subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOT5 PE=1 SV=1 1 231 4.0E-46
sp|Q8K0V4|CNOT3_MOUSE CCR4-NOT transcription complex subunit 3 OS=Mus musculus GN=Cnot3 PE=1 SV=1 506 642 2.0E-34
sp|O75175|CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens GN=CNOT3 PE=1 SV=1 506 642 3.0E-34
sp|Q12514|NOT5_YEAST General negative regulator of transcription subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOT5 PE=1 SV=1 502 637 2.0E-12
sp|P87240|NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not2 PE=1 SV=2 443 642 2.0E-10
sp|Q9NZN8|CNOT2_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens GN=CNOT2 PE=1 SV=1 557 642 1.0E-09
sp|Q8C5L3|CNOT2_MOUSE CCR4-NOT transcription complex subunit 2 OS=Mus musculus GN=Cnot2 PE=1 SV=2 557 642 1.0E-09
sp|Q52JK6|VIP2_NICBE Probable NOT transcription complex subunit VIP2 (Fragment) OS=Nicotiana benthamiana GN=VIP2 PE=1 SV=1 555 641 2.0E-09
sp|Q9FPW4|VIP2_ARATH Probable NOT transcription complex subunit VIP2 OS=Arabidopsis thaliana GN=VIP2 PE=1 SV=2 555 641 2.0E-07
sp|P06102|NOT3_YEAST General negative regulator of transcription subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOT3 PE=1 SV=2 478 641 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0065007 biological regulation No
GO:0005575 cellular_component No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0043226 organelle No
GO:0031323 regulation of cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4842
MAARKLQQEVDKCFKKVSEGVAEFEAIYEKIEQSNNPAQKEKLEDNLKREIKKLQRLRDQIKTWAASNDIKDKAP
LLEHRKLIETQMEKFKAVEKAMKTKAYSKEGLSAAAKLDPKEQAKVEASEFLSSMVDELEQQIESLEAEGESIQA
TMKKGKSQTAKAERMAEIERVIERHKWHQGKLELIRRTLENGGIEADQVTNLEENIRYYVTDGMNDDYVEDDEMY
TELALEEEEGVFGMGQDADKGSSLDAQSVPDDTFAAEPELPAPKPSSRRGGPKDTDSNSGGGGNRKASAPAKSPL
PSLATLHSPLTATSNGGSGVPAMKPASVPTRPAGEGLKYASAAAAAAASDKNNVGIAPLPPPPGSAAASIMALPP
AQSKASATSSPASTSVQPVAPQQPQPAGSFSDVETSSSSTLRPKKSKVAGKQSAAPAEAPAERPRVPTPASTAQS
NGTSNGTTAKPIKSIAEEPEEEESIYHLPSSLQDLVEVYELSKQQPVTSTATPAAQRMMATSQATCPETHDAEVP
RIYRPDLPLQQPNSSFPREMLPIFDDPRLYSRIDPDTLFYVFYYKQGTAQQYLAAKALKDQSWRFHKQYQTWFQR
HEEPKNITEEFEQGTYRFFDYESTWMNRRKADFKFAYKFLEDDV*
Coding >OphauB2|4842
ATGGCAGCACGAAAGTTGCAACAAGAAGTCGACAAGTGCTTCAAAAAAGTATCAGAAGGAGTTGCCGAATTCGAA
GCGATTTACGAAAAGATTGAGCAATCAAACAATCCGGCTCAAAAAGAAAAACTGGAGGACAACTTGAAGCGCGAA
ATCAAGAAGCTCCAGCGGTTGCGGGATCAAATCAAGACATGGGCGGCAAGCAACGATATCAAGGACAAGGCTCCG
TTGCTGGAGCATCGGAAGCTGATAGAAACGCAAATGGAAAAATTCAAGGCTGTTGAAAAGGCCATGAAGACCAAG
GCCTACTCCAAGGAAGGCTTGTCGGCAGCGGCCAAGCTGGACCCCAAGGAGCAGGCCAAGGTGGAGGCATCCGAA
TTTCTGAGTAGCATGGTGGACGAACTGGAGCAGCAGATTGAATCACTCGAGGCCGAGGGAGAATCGATACAAGCC
ACCATGAAGAAGGGCAAGAGCCAAACGGCCAAGGCGGAGCGCATGGCCGAGATTGAGCGGGTAATTGAGCGCCAC
AAGTGGCATCAAGGCAAACTAGAGCTTATCCGGCGGACGCTGGAAAACGGAGGCATCGAGGCGGACCAAGTCACC
AATCTGGAGGAAAACATCAGATACTACGTGACGGACGGCATGAATGACGACTATGTTGAAGACGACGAAATGTAC
ACGGAGCTGGCTCTCGAGGAGGAGGAAGGCGTTTTTGGCATGGGCCAAGATGCAGACAAGGGCTCGTCGCTCGAT
GCGCAGTCGGTGCCAGACGACACATTTGCAGCAGAGCCCGAACTGCCGGCGCCGAAGCCGTCGTCGAGACGAGGA
GGGCCCAAGGATACGGATAGCAACTCTGGGGGGGGAGGCAATCGAAAGGCGTCGGCACCAGCCAAGTCTCCCCTC
CCCTCATTAGCGACACTGCACTCGCCCCTGACGGCAACGAGCAATGGGGGTTCTGGCGTCCCCGCCATGAAGCCG
GCCTCGGTTCCCACTCGACCTGCCGGCGAAGGCTTGAAGTACGCATCTGCAGCAGCTGCGGCAGCCGCAAGTGAC
AAGAACAATGTGGGCATTGCGCCTCTGCCTCCGCCTCCCGGATCTGCTGCTGCTTCAATAATGGCCTTGCCGCCC
GCTCAGTCCAAGGCAAGTGCTACGAGCTCGCCTGCAAGCACGTCAGTACAGCCCGTTGCGCCCCAGCAACCACAG
CCTGCTGGCTCCTTTAGCGACGTCGAAACCTCGAGTAGCAGCACTTTGCGGCCCAAAAAGTCCAAAGTGGCAGGC
AAACAATCGGCAGCGCCGGCCGAAGCGCCGGCAGAACGGCCCCGTGTTCCTACACCGGCGTCGACAGCGCAATCC
AATGGCACCTCCAACGGAACGACGGCGAAGCCCATCAAGTCGATTGCGGAGGAGCCAGAAGAAGAAGAAAGTATA
TACCATTTGCCTTCTTCGCTGCAAGACTTGGTCGAGGTGTACGAGCTGTCGAAGCAGCAGCCCGTCACGTCGACT
GCAACGCCCGCAGCGCAGCGAATGATGGCGACAAGCCAAGCCACTTGTCCAGAGACGCACGATGCCGAGGTGCCG
CGGATATACCGGCCAGACCTGCCTCTGCAGCAGCCCAATTCGTCGTTTCCGCGTGAGATGCTTCCCATTTTTGAC
GACCCCCGCCTCTACTCGCGCATAGATCCAGACACGCTGTTTTACGTCTTTTACTACAAGCAAGGGACAGCCCAG
CAATATCTGGCGGCCAAGGCGCTCAAGGATCAGAGCTGGCGCTTCCACAAGCAGTATCAAACGTGGTTCCAGCGA
CACGAAGAGCCCAAGAATATAACGGAGGAGTTTGAGCAGGGCACGTATCGCTTCTTTGACTATGAGAGCACGTGG
ATGAACCGTCGGAAAGCAGACTTTAAGTTTGCATACAAGTTTCTCGAGGACGATGTTTGA
Transcript >OphauB2|4842
ATGGCAGCACGAAAGTTGCAACAAGAAGTCGACAAGTGCTTCAAAAAAGTATCAGAAGGAGTTGCCGAATTCGAA
GCGATTTACGAAAAGATTGAGCAATCAAACAATCCGGCTCAAAAAGAAAAACTGGAGGACAACTTGAAGCGCGAA
ATCAAGAAGCTCCAGCGGTTGCGGGATCAAATCAAGACATGGGCGGCAAGCAACGATATCAAGGACAAGGCTCCG
TTGCTGGAGCATCGGAAGCTGATAGAAACGCAAATGGAAAAATTCAAGGCTGTTGAAAAGGCCATGAAGACCAAG
GCCTACTCCAAGGAAGGCTTGTCGGCAGCGGCCAAGCTGGACCCCAAGGAGCAGGCCAAGGTGGAGGCATCCGAA
TTTCTGAGTAGCATGGTGGACGAACTGGAGCAGCAGATTGAATCACTCGAGGCCGAGGGAGAATCGATACAAGCC
ACCATGAAGAAGGGCAAGAGCCAAACGGCCAAGGCGGAGCGCATGGCCGAGATTGAGCGGGTAATTGAGCGCCAC
AAGTGGCATCAAGGCAAACTAGAGCTTATCCGGCGGACGCTGGAAAACGGAGGCATCGAGGCGGACCAAGTCACC
AATCTGGAGGAAAACATCAGATACTACGTGACGGACGGCATGAATGACGACTATGTTGAAGACGACGAAATGTAC
ACGGAGCTGGCTCTCGAGGAGGAGGAAGGCGTTTTTGGCATGGGCCAAGATGCAGACAAGGGCTCGTCGCTCGAT
GCGCAGTCGGTGCCAGACGACACATTTGCAGCAGAGCCCGAACTGCCGGCGCCGAAGCCGTCGTCGAGACGAGGA
GGGCCCAAGGATACGGATAGCAACTCTGGGGGGGGAGGCAATCGAAAGGCGTCGGCACCAGCCAAGTCTCCCCTC
CCCTCATTAGCGACACTGCACTCGCCCCTGACGGCAACGAGCAATGGGGGTTCTGGCGTCCCCGCCATGAAGCCG
GCCTCGGTTCCCACTCGACCTGCCGGCGAAGGCTTGAAGTACGCATCTGCAGCAGCTGCGGCAGCCGCAAGTGAC
AAGAACAATGTGGGCATTGCGCCTCTGCCTCCGCCTCCCGGATCTGCTGCTGCTTCAATAATGGCCTTGCCGCCC
GCTCAGTCCAAGGCAAGTGCTACGAGCTCGCCTGCAAGCACGTCAGTACAGCCCGTTGCGCCCCAGCAACCACAG
CCTGCTGGCTCCTTTAGCGACGTCGAAACCTCGAGTAGCAGCACTTTGCGGCCCAAAAAGTCCAAAGTGGCAGGC
AAACAATCGGCAGCGCCGGCCGAAGCGCCGGCAGAACGGCCCCGTGTTCCTACACCGGCGTCGACAGCGCAATCC
AATGGCACCTCCAACGGAACGACGGCGAAGCCCATCAAGTCGATTGCGGAGGAGCCAGAAGAAGAAGAAAGTATA
TACCATTTGCCTTCTTCGCTGCAAGACTTGGTCGAGGTGTACGAGCTGTCGAAGCAGCAGCCCGTCACGTCGACT
GCAACGCCCGCAGCGCAGCGAATGATGGCGACAAGCCAAGCCACTTGTCCAGAGACGCACGATGCCGAGGTGCCG
CGGATATACCGGCCAGACCTGCCTCTGCAGCAGCCCAATTCGTCGTTTCCGCGTGAGATGCTTCCCATTTTTGAC
GACCCCCGCCTCTACTCGCGCATAGATCCAGACACGCTGTTTTACGTCTTTTACTACAAGCAAGGGACAGCCCAG
CAATATCTGGCGGCCAAGGCGCTCAAGGATCAGAGCTGGCGCTTCCACAAGCAGTATCAAACGTGGTTCCAGCGA
CACGAAGAGCCCAAGAATATAACGGAGGAGTTTGAGCAGGGCACGTATCGCTTCTTTGACTATGAGAGCACGTGG
ATGAACCGTCGGAAAGCAGACTTTAAGTTTGCATACAAGTTTCTCGAGGACGATGTTTGA
Gene >OphauB2|4842
ATGGCAGCACGAAAGTTGCAACAAGAAGTCGACAAGTGCTTCAAAAAAGTATCAGAAGGAGTTGCCGAATTCGAA
GCGATTTACGAAAAGATTGAGCAATCAAACAATCCGGCTCAAAAAGAAAAACTGGAGGACAACTTGAAGCGCGAA
ATCAAGAAGCTCCAGCGGTTGCGGGATCAAATCAAGACATGGGCGGCAAGCAACGATATCAAGGACAAGGCTCCG
TTGCTGGAGCATCGGAAGCTGATAGAAACGGTGAGAGTGGTGGGTCCATGGACTGAGGGCCCCGTCGTGCTGATG
GCCAAGTGTGACTGTAGCAAATGGAAAAATTCAAGGCTGTTGAAAAGGCCATGAAGACCAAGGCCTACTCCAAGG
AAGGCTTGTCGGCAGCGGCCAAGCTGGACCCCAAGGAGCAGGCCAAGGTGGAGGCATCCGAATTTCTGAGTAGCA
TGGTGGACGAACTGGAGCAGCAGATTGAATCACTCGAGGCCGAGGGAGAATCGATACAAGCCACCATGAAGAAGG
GCAAGAGCCAAACGGCCAAGGCGGAGCGCATGGCCGAGATTGAGCGGGTAATTGAGCGCCACAAGTGGCATCAAG
GCAAACTAGAGCTTATCCGGCGGACGCTGGAAAACGGAGGCATCGAGGCGGACCAAGTCACCAATCTGGAGGAAA
ACATCAGATACTACGTGACGGACGGCATGAATGACGACTATGTTGAAGACGACGAAATGTACACGGAGCTGGCTC
TCGAGGAGGAGGAAGGCGTTTTTGGCATGGGCCAAGATGCAGACAAGGGCTCGTCGCTCGATGCGCAGTCGGTGC
CAGACGACACATTTGCAGCAGAGCCCGAACTGCCGGCGCCGAAGCCGTCGTCGAGACGAGGAGGGCCCAAGGATA
CGGATAGCAACTCTGGGGGGGGAGGCAATCGAAAGGCGTCGGCACCAGCCAAGTCTCCCCTCCCCTCATTAGCGA
CACTGCACTCGCCCCTGACGGCAACGAGCAATGGGGGTTCTGGCGTCCCCGCCATGAAGCCGGCCTCGGTTCCCA
CTCGACCTGCCGGCGAAGGCTTGAAGTACGCATCTGCAGCAGCTGCGGCAGCCGCAAGTGACAAGAACAATGTGG
GCATTGCGCCTCTGCCTCCGCCTCCCGGATCTGCTGCTGCTTCAATAATGGCCTTGCCGCCCGCTCAGTCCAAGG
CAAGTGCTACGAGCTCGCCTGCAAGCACGTCAGTACAGCCCGTTGCGCCCCAGCAACCACAGCCTGCTGGCTCCT
TTAGCGACGTCGAAACCTCGAGTAGCAGCACTTTGCGGCCCAAAAAGTCCAAAGTGGCAGGCAAACAATCGGCAG
CGCCGGCCGAAGCGCCGGCAGAACGGCCCCGTGGTAAGTCGGAGTGCGATTTTGGTGTCGGGTCTAGTCGGCTGA
TGATGTCTTGTCTCTTTTGTTTTTTTTTCGTTGCCAGTTCCTACACCGGCGTCGACAGCGCAATCCAATGGCACC
TCCAACGGAACGACGGCGAAGCCCATCAAGTCGATTGCGGAGGAGCCAGAAGAAGAAGAAAGTATATACCATTTG
CCTTCTTCGCTGCAAGACTTGGTCGAGGTGTACGAGCTGTCGAAGCAGCAGCCCGTCACGTCGACTGCAACGCCC
GCAGCGCAGCGAATGATGGCGACAAGCCAAGCCACTTGTCCAGAGACGCACGATGCCGAGGTGCCGCGGATATAC
CGGCCAGACCTGCCTCTGCAGCAGCCCAATTCGTCGTTTCCGCGTGAGATGCTTCCCATTTTTGACGACCCCCGC
CTCTACTCGCGCATAGATCCAGACACGCTGTTTTACGTCTTTTACTACAAGCAAGGGACAGCCCAGCAATATCTG
GCGGCCAAGGCGCTCAAGGATCAGAGCTGGCGCTTCCACAAGCAGTATCAAACGTGGTTCCAGCGACACGAAGAG
CCCAAGAATATAACGGAGGAGTTTGAGCAGGGCACGTATCGCTTCTTTGACTATGAGAGCACGTGGTGAGTTGAG
CAGAGGCTGATGAGCAAGGCGACAGGCACTGACGAAGCGCAGGATGAACCGTCGGAAAGCAGACTTTAAGTTTGC
ATACAAGTTTCTCGAGGACGATGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail