Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4839
Gene name
LocationContig_34:55381..55735
Strand+
Gene length (bp)354
Transcript length (bp)354
Coding sequence length (bp)354
Protein length (aa) 118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 2.2E-06 2 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A0L576|ACSA_MAGMM Acetyl-coenzyme A synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acsA PE=3 SV=1 1 91 3.0E-11
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 1 75 6.0E-11
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 1 75 4.0E-10
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 1 75 4.0E-10
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 1 75 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A0L576|ACSA_MAGMM Acetyl-coenzyme A synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acsA PE=3 SV=1 1 91 3.0E-11
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 1 75 6.0E-11
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 1 75 4.0E-10
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 1 75 4.0E-10
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 1 75 6.0E-10
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 1 92 1.0E-09
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 1 92 1.0E-09
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 2 91 1.0E-09
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 2 91 2.0E-09
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 2 91 3.0E-09
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 2 81 3.0E-09
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 2 81 4.0E-09
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 2 75 4.0E-09
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 2 81 4.0E-09
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 2 90 5.0E-09
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 1 75 5.0E-09
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 2 90 5.0E-09
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 1 75 5.0E-09
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 1 75 6.0E-09
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 2 81 6.0E-09
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 2 91 6.0E-09
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 1 75 7.0E-09
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 1 75 8.0E-09
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 2 77 8.0E-09
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 1 75 1.0E-08
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 1 75 1.0E-08
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 1 75 1.0E-08
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 1 75 1.0E-08
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 1 75 1.0E-08
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 1 75 1.0E-08
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 1 75 1.0E-08
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 1 75 1.0E-08
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 1 75 1.0E-08
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 1 75 1.0E-08
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 1 75 1.0E-08
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 2 90 2.0E-08
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 2 91 2.0E-08
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 1 75 2.0E-08
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 1 75 2.0E-08
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 1 92 2.0E-08
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 2 91 3.0E-08
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 2 91 3.0E-08
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 2 91 3.0E-08
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 2 77 5.0E-08
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 2 91 5.0E-08
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 2 77 6.0E-08
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 1 92 8.0E-08
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 1 92 8.0E-08
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 1 92 1.0E-07
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 2 91 2.0E-07
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 2 78 2.0E-07
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 2 109 2.0E-07
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 2 104 2.0E-07
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 2 91 2.0E-07
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 2 91 2.0E-07
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 2 91 2.0E-07
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 2 75 2.0E-07
sp|Q6FYL4|ACSA_BARQU Acetyl-coenzyme A synthetase OS=Bartonella quintana (strain Toulouse) GN=acsA PE=3 SV=1 2 90 3.0E-07
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 1 75 3.0E-07
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 2 91 4.0E-07
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 1 91 4.0E-07
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 2 91 5.0E-07
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 1 75 5.0E-07
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 3 91 5.0E-07
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 2 91 6.0E-07
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 2 91 7.0E-07
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 2 91 7.0E-07
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 2 75 7.0E-07
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 2 91 8.0E-07
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 2 75 8.0E-07
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 2 91 8.0E-07
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 2 91 8.0E-07
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 2 91 8.0E-07
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 2 91 9.0E-07
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 2 91 9.0E-07
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 2 91 9.0E-07
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 2 75 2.0E-06
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 2 75 2.0E-06
sp|Q056J9|ACSA_LEPBL Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acsA PE=3 SV=1 2 110 2.0E-06
sp|Q04P35|ACSA_LEPBJ Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acsA PE=3 SV=1 2 110 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4839
MPHHLKGQLPFAFVTLTALPAQLSAAPRANISLEIQALVRKQVGAIASLGGIVYGKDIIPRTRSGKPLRRVLRQL
LEQAVDGKLDGLLGDSGGEICQAQKRVKEFFDDRRLVGQAQQ*
Coding >OphauB2|4839
ATGCCCCATCACCTCAAGGGCCAGCTCCCCTTTGCCTTTGTCACCCTCACCGCCCTGCCCGCCCAGCTCTCTGCC
GCCCCGCGGGCAAACATTTCCCTCGAGATCCAGGCCCTGGTGCGCAAGCAAGTCGGCGCCATTGCCTCGCTCGGC
GGCATCGTCTACGGCAAGGACATTATTCCCAGGACTCGCTCCGGCAAGCCGCTGCGCCGCGTCCTCCGCCAGCTC
CTGGAACAGGCTGTAGACGGAAAGCTCGACGGACTGCTGGGCGACAGCGGAGGAGAGATTTGCCAGGCGCAAAAG
AGGGTAAAGGAGTTTTTTGACGACAGGCGGCTCGTGGGCCAAGCACAACAATGA
Transcript >OphauB2|4839
ATGCCCCATCACCTCAAGGGCCAGCTCCCCTTTGCCTTTGTCACCCTCACCGCCCTGCCCGCCCAGCTCTCTGCC
GCCCCGCGGGCAAACATTTCCCTCGAGATCCAGGCCCTGGTGCGCAAGCAAGTCGGCGCCATTGCCTCGCTCGGC
GGCATCGTCTACGGCAAGGACATTATTCCCAGGACTCGCTCCGGCAAGCCGCTGCGCCGCGTCCTCCGCCAGCTC
CTGGAACAGGCTGTAGACGGAAAGCTCGACGGACTGCTGGGCGACAGCGGAGGAGAGATTTGCCAGGCGCAAAAG
AGGGTAAAGGAGTTTTTTGACGACAGGCGGCTCGTGGGCCAAGCACAACAATGA
Gene >OphauB2|4839
ATGCCCCATCACCTCAAGGGCCAGCTCCCCTTTGCCTTTGTCACCCTCACCGCCCTGCCCGCCCAGCTCTCTGCC
GCCCCGCGGGCAAACATTTCCCTCGAGATCCAGGCCCTGGTGCGCAAGCAAGTCGGCGCCATTGCCTCGCTCGGC
GGCATCGTCTACGGCAAGGACATTATTCCCAGGACTCGCTCCGGCAAGCCGCTGCGCCGCGTCCTCCGCCAGCTC
CTGGAACAGGCTGTAGACGGAAAGCTCGACGGACTGCTGGGCGACAGCGGAGGAGAGATTTGCCAGGCGCAAAAG
AGGGTAAAGGAGTTTTTTGACGACAGGCGGCTCGTGGGCCAAGCACAACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail