Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4833
Gene name
LocationContig_34:42884..44720
Strand-
Gene length (bp)1836
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1 1.8E-63 151 600

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q25BW4|BGL1B_PHACH Beta-glucosidase 1B OS=Phanerochaete chrysosporium GN=BGL1B PE=1 SV=1 146 597 4.0E-56
sp|Q25BW5|BGL1A_PHACH Beta-glucosidase 1A OS=Phanerochaete chrysosporium GN=BGL1A PE=1 SV=1 148 597 1.0E-52
sp|Q5N863|BGL04_ORYSJ Beta-glucosidase 4 OS=Oryza sativa subsp. japonica GN=BGLU4 PE=2 SV=1 151 586 8.0E-51
sp|Q9FIW4|BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana GN=BGLU42 PE=2 SV=1 151 607 4.0E-48
sp|Q6UWM7|LCTL_HUMAN Lactase-like protein OS=Homo sapiens GN=LCTL PE=1 SV=2 152 597 3.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q25BW4|BGL1B_PHACH Beta-glucosidase 1B OS=Phanerochaete chrysosporium GN=BGL1B PE=1 SV=1 146 597 4.0E-56
sp|Q25BW5|BGL1A_PHACH Beta-glucosidase 1A OS=Phanerochaete chrysosporium GN=BGL1A PE=1 SV=1 148 597 1.0E-52
sp|Q5N863|BGL04_ORYSJ Beta-glucosidase 4 OS=Oryza sativa subsp. japonica GN=BGLU4 PE=2 SV=1 151 586 8.0E-51
sp|Q9FIW4|BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana GN=BGLU42 PE=2 SV=1 151 607 4.0E-48
sp|Q6UWM7|LCTL_HUMAN Lactase-like protein OS=Homo sapiens GN=LCTL PE=1 SV=2 152 597 3.0E-46
sp|Q0J0N4|BGL30_ORYSJ Beta-glucosidase 30 OS=Oryza sativa subsp. japonica GN=BGLU30 PE=2 SV=1 152 606 1.0E-45
sp|Q9M1D1|BGL27_ARATH Beta-glucosidase 27 OS=Arabidopsis thaliana GN=BGLU27 PE=2 SV=2 151 586 1.0E-45
sp|O64883|BGL26_ARATH Beta-glucosidase 26, peroxisomal OS=Arabidopsis thaliana GN=BGLU26 PE=1 SV=1 152 606 5.0E-44
sp|Q9LV34|BGL43_ARATH Beta-glucosidase 43 OS=Arabidopsis thaliana GN=BGLU43 PE=2 SV=2 123 597 8.0E-44
sp|Q8K1F9|LCTL_MOUSE Lactase-like protein OS=Mus musculus GN=Lctl PE=2 SV=1 152 597 9.0E-44
sp|Q9LV33|BGL44_ARATH Beta-glucosidase 44 OS=Arabidopsis thaliana GN=BGLU44 PE=2 SV=1 145 597 1.0E-43
sp|Q9ZT64|CBG_PINCO Coniferin beta-glucosidase OS=Pinus contorta PE=1 SV=1 151 596 1.0E-43
sp|Q9FLU8|BGL32_ARATH Beta-glucosidase 32 OS=Arabidopsis thaliana GN=BGLU32 PE=2 SV=2 152 609 2.0E-43
sp|Q7EXZ4|BGL28_ORYSJ Beta-glucosidase 28 OS=Oryza sativa subsp. japonica GN=BGLU28 PE=2 SV=1 152 606 2.0E-43
sp|Q75I94|BGL08_ORYSJ Beta-glucosidase 8 OS=Oryza sativa subsp. japonica GN=BGLU8 PE=1 SV=1 142 597 2.0E-43
sp|Q84YK7|BGL27_ORYSJ Beta-glucosidase 27 OS=Oryza sativa subsp. japonica GN=BGLU27 PE=2 SV=1 152 606 5.0E-43
sp|Q9FLU9|BGL31_ARATH Beta-glucosidase 31 OS=Arabidopsis thaliana GN=BGLU31 PE=2 SV=1 152 609 5.0E-43
sp|Q9FZE0|BGL40_ARATH Beta-glucosidase 40 OS=Arabidopsis thaliana GN=BGLU40 PE=2 SV=1 152 607 8.0E-43
sp|Q339X2|BGL34_ORYSJ Beta-glucosidase 34 OS=Oryza sativa subsp. japonica GN=BGLU34 PE=2 SV=1 145 597 1.0E-42
sp|Q7XKV5|BGL11_ORYSJ Beta-glucosidase 11 OS=Oryza sativa subsp. japonica GN=BGLU11 PE=3 SV=2 146 597 2.0E-42
sp|Q5QMT0|BGL01_ORYSJ Beta-glucosidase 1 OS=Oryza sativa subsp. japonica GN=BGLU1 PE=2 SV=1 145 603 2.0E-42
sp|A3C053|BGL29_ORYSJ Beta-glucosidase 29 OS=Oryza sativa subsp. japonica GN=BGLU29 PE=2 SV=2 152 608 3.0E-42
sp|Q5RF65|GBA3_PONAB Cytosolic beta-glucosidase OS=Pongo abelii GN=GBA3 PE=2 SV=1 152 582 2.0E-41
sp|Q8L7J2|BGL06_ORYSJ Beta-glucosidase 6 OS=Oryza sativa subsp. japonica GN=BGLU6 PE=1 SV=1 152 597 5.0E-41
sp|Q42707|F26G_CHESP Furostanol glycoside 26-O-beta-glucosidase OS=Cheilocostus speciosus GN=F26G PE=1 SV=1 125 586 5.0E-41
sp|O64882|BGL17_ARATH Beta-glucosidase 17 OS=Arabidopsis thaliana GN=BGLU17 PE=2 SV=1 152 597 6.0E-41
sp|Q3ECS3|BGL35_ARATH Myrosinase 5 OS=Arabidopsis thaliana GN=TGG5 PE=1 SV=1 152 589 7.0E-41
sp|A3BMZ5|BGL26_ORYSJ Beta-glucosidase 26 OS=Oryza sativa subsp. japonica GN=BGLU26 PE=1 SV=1 152 599 1.0E-40
sp|Q9H227|GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens GN=GBA3 PE=1 SV=2 152 582 1.0E-40
sp|Q5Z9Z0|BGL24_ORYSJ Beta-glucosidase 24 OS=Oryza sativa subsp. japonica GN=BGLU24 PE=2 SV=1 152 597 1.0E-40
sp|Q7XKV4|BGL12_ORYSJ Beta-glucosidase 12 OS=Oryza sativa subsp. japonica GN=BGLU12 PE=1 SV=2 146 597 2.0E-40
sp|Q8GXT2|BGL29_ARATH Beta-glucosidase 29 OS=Arabidopsis thaliana GN=BGLU29 PE=2 SV=2 152 597 3.0E-40
sp|Q95X01|MYRO1_BREBR Myrosinase 1 OS=Brevicoryne brassicae PE=1 SV=1 152 592 3.0E-40
sp|P09849|LPH_RABIT Lactase-phlorizin hydrolase OS=Oryctolagus cuniculus GN=LCT PE=1 SV=1 152 609 4.0E-40
sp|B8AVF0|BGL12_ORYSI Beta-glucosidase 12 OS=Oryza sativa subsp. indica GN=BGLU12 PE=3 SV=1 146 597 7.0E-40
sp|Q08638|BGLA_THEMA Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=bglA PE=1 SV=1 152 597 8.0E-40
sp|Q9M1C9|BGL30_ARATH Beta-glucosidase 30 OS=Arabidopsis thaliana GN=BGLU30 PE=2 SV=1 152 597 8.0E-40
sp|Q9C8Y9|BGL22_ARATH Beta-glucosidase 22 OS=Arabidopsis thaliana GN=BGLU22 PE=1 SV=1 121 597 1.0E-39
sp|B7F7K7|BGL31_ORYSJ Beta-glucosidase 31 OS=Oryza sativa subsp. japonica GN=BGLU31 PE=2 SV=1 151 593 2.0E-39
sp|Q9LU02|BGL13_ARATH Beta-glucosidase 13 OS=Arabidopsis thaliana GN=BGLU13 PE=2 SV=1 119 597 2.0E-39
sp|B9K7M5|BGLA_THENN 1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gghA PE=1 SV=2 152 597 2.0E-39
sp|Q60DX8|BGL22_ORYSJ Beta-glucosidase 22 OS=Oryza sativa subsp. japonica GN=BGLU22 PE=2 SV=1 151 586 2.0E-39
sp|Q75I93|BGL07_ORYSJ Beta-glucosidase 7 OS=Oryza sativa subsp. japonica GN=BGLU7 PE=1 SV=1 139 599 3.0E-39
sp|Q4V3B3|BGL28_ARATH Beta-glucosidase 28 OS=Arabidopsis thaliana GN=BGLU28 PE=2 SV=1 152 586 3.0E-39
sp|P97265|GBA3_CAVPO Cytosolic beta-glucosidase OS=Cavia porcellus GN=Gba3 PE=1 SV=1 152 582 4.0E-39
sp|Q9SPP9|RG1_RAUSE Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina GN=RG PE=1 SV=1 148 582 4.0E-39
sp|O64879|BGL15_ARATH Beta-glucosidase 15 OS=Arabidopsis thaliana GN=BGLU15 PE=1 SV=1 151 597 4.0E-39
sp|Q9FH03|BGL12_ARATH Beta-glucosidase 12 OS=Arabidopsis thaliana GN=BGLU12 PE=2 SV=1 151 597 4.0E-39
sp|Q7F9K4|BGL10_ORYSJ Beta-glucosidase 10 OS=Oryza sativa subsp. japonica GN=BGLU10 PE=2 SV=1 146 606 6.0E-39
sp|Q8GRX1|BGL34_ARATH Myrosinase 4 OS=Arabidopsis thaliana GN=TGG4 PE=1 SV=1 152 589 8.0E-39
sp|Q9M1D0|BGL16_ARATH Beta-glucosidase 16 OS=Arabidopsis thaliana GN=BGLU16 PE=2 SV=1 151 597 8.0E-39
sp|P0C946|BGLA_THENE 1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana GN=bglA PE=3 SV=1 152 592 8.0E-39
sp|O80690|BGL46_ARATH Beta-glucosidase 46 OS=Arabidopsis thaliana GN=BGLU46 PE=1 SV=2 152 597 1.0E-38
sp|Q8GU20|SG1_RAUSE Strictosidine-O-beta-D-glucosidase OS=Rauvolfia serpentina GN=SGR1 PE=1 SV=1 151 597 1.0E-38
sp|Q7XSK0|BGL18_ORYSJ Beta-glucosidase 18 OS=Oryza sativa subsp. japonica GN=BGLU18 PE=3 SV=2 151 592 1.0E-38
sp|Q7XKV2|BGL13_ORYSJ Beta-glucosidase 13 OS=Oryza sativa subsp. japonica GN=BGLU13 PE=2 SV=2 146 596 2.0E-38
sp|O82772|BGL25_ARATH Probable inactive beta-glucosidase 25 OS=Arabidopsis thaliana GN=BGLU25 PE=2 SV=1 120 586 5.0E-38
sp|E3W9M2|AA5GT_DIACA Cyanidin 3-O-glucoside 5-O-glucosyltransferase (acyl-glucose) OS=Dianthus caryophyllus GN=AA5GT PE=1 SV=1 151 573 5.0E-38
sp|Q9SR37|BGL23_ARATH Beta-glucosidase 23 OS=Arabidopsis thaliana GN=BGLU23 PE=1 SV=1 136 597 8.0E-38
sp|Q9ZUI3|BGL04_ARATH Beta-glucosidase 4 OS=Arabidopsis thaliana GN=BGLU4 PE=2 SV=2 148 592 1.0E-37
sp|Q0DA21|BGL25_ORYSJ Beta-glucosidase 25 OS=Oryza sativa subsp. japonica GN=BGLU25 PE=2 SV=2 148 586 1.0E-37
sp|Q9SLA0|BGL14_ARATH Beta-glucosidase 14 OS=Arabidopsis thaliana GN=BGLU14 PE=3 SV=2 151 597 2.0E-37
sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegicus GN=Lct PE=2 SV=2 152 603 2.0E-37
sp|O05508|GMUD_BACSU 6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) GN=gmuD PE=1 SV=1 152 597 4.0E-37
sp|P26204|BGLS_TRIRP Non-cyanogenic beta-glucosidase OS=Trifolium repens PE=1 SV=1 122 586 6.0E-37
sp|B7F8N7|BGL02_ORYSJ Beta-glucosidase 2 OS=Oryza sativa subsp. japonica GN=BGLU2 PE=2 SV=1 151 586 6.0E-37
sp|P09848|LPH_HUMAN Lactase-phlorizin hydrolase OS=Homo sapiens GN=LCT PE=1 SV=3 152 609 7.0E-37
sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegicus GN=Lct PE=2 SV=2 152 609 9.0E-37
sp|P09849|LPH_RABIT Lactase-phlorizin hydrolase OS=Oryctolagus cuniculus GN=LCT PE=1 SV=1 152 602 1.0E-36
sp|B3H5Q1|BGL11_ARATH Beta-glucosidase 11 OS=Arabidopsis thaliana GN=BGLU11 PE=2 SV=2 151 586 1.0E-36
sp|Q9SVS1|BGL47_ARATH Beta-glucosidase 47 OS=Arabidopsis thaliana GN=BGLU47 PE=3 SV=2 152 592 1.0E-36
sp|O48779|BGL33_ARATH Beta-glucosidase 33 OS=Arabidopsis thaliana GN=BGLU33 PE=2 SV=1 142 608 4.0E-36
sp|Q9LKR7|BGL24_ARATH Beta-glucosidase 24 OS=Arabidopsis thaliana GN=BGLU24 PE=2 SV=2 136 586 4.0E-36
sp|Q93ZI4|BGL10_ARATH Beta-glucosidase 10 OS=Arabidopsis thaliana GN=BGLU10 PE=2 SV=1 151 586 4.0E-36
sp|Q9C525|BGL21_ARATH Beta-glucosidase 21 OS=Arabidopsis thaliana GN=BGLU21 PE=1 SV=1 152 597 4.0E-36
sp|O65458|BGL03_ARATH Beta-glucosidase 3 OS=Arabidopsis thaliana GN=BGLU3 PE=3 SV=2 151 592 5.0E-36
sp|Q53NF0|BGL35_ORYSJ Putative beta-glucosidase 35 OS=Oryza sativa subsp. japonica GN=BGLU35 PE=3 SV=2 152 608 7.0E-36
sp|P09848|LPH_HUMAN Lactase-phlorizin hydrolase OS=Homo sapiens GN=LCT PE=1 SV=3 152 592 1.0E-35
sp|Q7XSK2|BGL16_ORYSJ Beta-glucosidase 16 OS=Oryza sativa subsp. japonica GN=BGLU16 PE=3 SV=2 151 592 2.0E-35
sp|Q75W17|FURH_VIBFR Furcatin hydrolase OS=Viburnum furcatum PE=1 SV=1 152 596 3.0E-35
sp|Q3ECW8|BGL01_ARATH Beta-glucosidase 1 OS=Arabidopsis thaliana GN=BGLU1 PE=2 SV=2 129 592 5.0E-35
sp|Q9LIF9|BGL19_ARATH Beta-glucosidase 19 OS=Arabidopsis thaliana GN=BGLU19 PE=2 SV=1 152 606 5.0E-35
sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegicus GN=Lct PE=2 SV=2 151 588 6.0E-35
sp|E3W9M3|AA7GT_DELGR Cyanidin 3-O-glucoside 7-O-glucosyltransferase (acyl-glucose) OS=Delphinium grandiflorum GN=AA7GT PE=1 SV=1 151 586 1.0E-34
sp|O80689|BGL45_ARATH Beta-glucosidase 45 OS=Arabidopsis thaliana GN=BGLU45 PE=1 SV=1 152 597 2.0E-34
sp|Q0J0G1|BGL33_ORYSJ Probable inactive beta-glucosidase 33 OS=Oryza sativa subsp. japonica GN=BGLU33 PE=2 SV=2 151 607 2.0E-34
sp|A2SY66|VICHY_VICSN Vicianin hydrolase (Fragment) OS=Vicia sativa subsp. nigra PE=1 SV=1 152 596 4.0E-34
sp|Q0J0G2|BGL32_ORYSJ Beta-glucosidase 32 OS=Oryza sativa subsp. japonica GN=BGLU32 PE=2 SV=2 151 597 4.0E-34
sp|Q1XH05|HGL1B_WHEAT 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase 1b, chloroplastic OS=Triticum aestivum GN=GLU1B PE=1 SV=1 107 597 6.0E-34
sp|P09848|LPH_HUMAN Lactase-phlorizin hydrolase OS=Homo sapiens GN=LCT PE=1 SV=3 152 586 1.0E-33
sp|Q84WV2|BGL20_ARATH Beta-glucosidase 20 OS=Arabidopsis thaliana GN=BGLU20 PE=2 SV=1 151 586 1.0E-33
sp|Q2QSR8|BGL38_ORYSJ Beta-glucosidase 38 OS=Oryza sativa subsp. japonica GN=BGLU38 PE=2 SV=2 152 597 1.0E-33
sp|Q9FYS3|HGGL_SECCE 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase, chloroplastic OS=Secale cereale PE=1 SV=1 107 597 2.0E-33
sp|Q67XN2|BGL08_ARATH Beta-glucosidase 8 OS=Arabidopsis thaliana GN=BGLU8 PE=2 SV=1 141 586 2.0E-33
sp|Q9STP4|BGL09_ARATH Beta-glucosidase 9 OS=Arabidopsis thaliana GN=BGLU9 PE=2 SV=2 152 586 3.0E-33
sp|A3RF67|BAGBG_DALNI Isoflavonoid 7-O-beta-apiosyl-glucoside beta-glycosidase OS=Dalbergia nigrescens PE=1 SV=1 152 597 4.0E-33
sp|D5MTF8|HGL1D_WHEAT 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase 1d, chloroplastic OS=Triticum aestivum GN=GLU1D PE=1 SV=1 107 597 5.0E-33
sp|Q8RXN9|BGL05_ARATH Putative beta-glucosidase 5 OS=Arabidopsis thaliana GN=BGLU5 PE=5 SV=2 148 592 9.0E-33
sp|Q7XPY7|BGL14_ORYSJ Probable inactive beta-glucosidase 14 OS=Oryza sativa subsp. japonica GN=BGLU14 PE=2 SV=2 152 592 1.0E-32
sp|Q8RZL1|BGL03_ORYSJ Beta-glucosidase 3 OS=Oryza sativa subsp. japonica GN=BGLU3 PE=2 SV=2 151 586 2.0E-32
sp|P94248|BGLFU_BIFBR Bifunctional beta-D-glucosidase/beta-D-fucosidase OS=Bifidobacterium breve PE=1 SV=1 152 598 4.0E-32
sp|Q1XIR9|HGL1A_WHEAT 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase 1a, chloroplastic OS=Triticum aestivum GN=GLU1A PE=1 SV=1 107 597 1.0E-31
sp|Q9FIU7|BGL41_ARATH Putative beta-glucosidase 41 OS=Arabidopsis thaliana GN=BGLU41 PE=3 SV=2 148 586 1.0E-31
sp|Q1XH04|HGL1C_WHEAT 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase 1c, chloroplastic OS=Triticum aestivum GN=GLU1C PE=1 SV=1 107 597 1.0E-31
sp|P09849|LPH_RABIT Lactase-phlorizin hydrolase OS=Oryctolagus cuniculus GN=LCT PE=1 SV=1 109 586 2.0E-31
sp|Q9ZP27|AVCO2_AVESA Avenacosidase 2 OS=Avena sativa GN=P60B PE=1 SV=1 107 597 2.0E-31
sp|P42973|BGLA_BACSU Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) GN=bglA PE=1 SV=1 151 598 4.0E-31
sp|Q9SE50|BGL18_ARATH Beta-D-glucopyranosyl abscisate beta-glucosidase OS=Arabidopsis thaliana GN=BGLU18 PE=1 SV=2 136 586 7.0E-31
sp|P26208|BGLA_CLOTH Beta-glucosidase A OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bglA PE=3 SV=1 152 597 7.0E-31
sp|Q682B4|BGL06_ARATH Putative beta-glucosidase 6 OS=Arabidopsis thaliana GN=BGLU6 PE=5 SV=1 151 443 8.0E-31
sp|P12614|BGLS_AGRSA Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) GN=abg PE=3 SV=1 152 597 8.0E-31
sp|Q38786|AVCO1_AVESA Avenacosidase 1 OS=Avena sativa GN=P60A PE=1 SV=1 129 597 1.0E-30
sp|P26206|ARBB_DICCH 6-phospho-beta-glucosidase OS=Dickeya chrysanthemi GN=arbB PE=3 SV=1 152 599 2.0E-30
sp|Q97EZ2|LACG_CLOAB 6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lacG PE=3 SV=1 151 597 7.0E-30
sp|Q03506|BGLA_BACCI Beta-glucosidase OS=Bacillus circulans GN=bglA PE=1 SV=3 152 599 7.0E-30
sp|P29736|MYRA_SINAL Myrosinase MA1 OS=Sinapis alba PE=1 SV=2 159 597 1.0E-29
sp|Q9LZJ1|BGL07_ARATH Beta-glucosidase 7 OS=Arabidopsis thaliana GN=BGLU7 PE=2 SV=2 121 586 2.0E-29
sp|P22073|BGLA_PAEPO Beta-glucosidase A OS=Paenibacillus polymyxa GN=bglA PE=1 SV=1 152 599 3.0E-29
sp|Q00326|MYRO_BRANA Myrosinase OS=Brassica napus PE=2 SV=1 148 586 4.0E-29
sp|Q0DIT2|BGL19_ORYSJ Beta-glucosidase 19 OS=Oryza sativa subsp. japonica GN=BGLU19 PE=2 SV=1 151 591 4.0E-29
sp|Q41761|HGGL2_MAIZE 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase 2, chloroplastic OS=Zea mays GN=GLU2 PE=1 SV=1 152 608 6.0E-29
sp|P22505|BGLB_PAEPO Beta-glucosidase B OS=Paenibacillus polymyxa GN=bglB PE=1 SV=1 152 609 2.0E-28
sp|Q86Z14|KLOTB_HUMAN Beta-klotho OS=Homo sapiens GN=KLB PE=1 SV=1 152 595 3.0E-28
sp|Q5JK35|BGL05_ORYSJ Beta-glucosidase 5 OS=Oryza sativa subsp. japonica GN=BGLU5 PE=2 SV=1 151 592 6.0E-28
sp|B9FHH2|BGL20_ORYSJ Beta-glucosidase 20 OS=Oryza sativa subsp. japonica GN=BGLU20 PE=2 SV=1 151 592 1.0E-27
sp|P29092|MYR3_SINAL Myrosinase MB3 OS=Sinapis alba PE=1 SV=1 148 586 2.0E-27
sp|P37702|BGL38_ARATH Myrosinase 1 OS=Arabidopsis thaliana GN=TGG1 PE=1 SV=1 151 586 5.0E-27
sp|Q46130|ABGA_CLOLO 6-phospho-beta-glucosidase OS=Clostridium longisporum GN=abgA PE=3 SV=1 152 598 7.0E-27
sp|P49235|HGGL1_MAIZE 4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase 1, chloroplastic OS=Zea mays GN=GLU1 PE=1 SV=1 152 608 9.0E-27
sp|Q60DY1|BGL21_ORYSJ Beta-glucosidase 21 OS=Oryza sativa subsp. japonica GN=BGLU21 PE=2 SV=2 151 592 1.0E-26
sp|P26205|BGLT_TRIRP Cyanogenic beta-glucosidase (Fragment) OS=Trifolium repens GN=LI PE=1 SV=1 125 439 2.0E-26
sp|Q8GVD0|BGLC_OLEEU Beta-glucosidase OS=Olea europaea GN=GLU PE=1 SV=1 151 586 2.0E-26
sp|Q9C5C2|BGL37_ARATH Myrosinase 2 OS=Arabidopsis thaliana GN=TGG2 PE=1 SV=1 151 606 2.0E-26
sp|P11988|BGLB_ECOLI 6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) GN=bglB PE=1 SV=2 152 610 3.0E-26
sp|Q3E8E5|BGL39_ARATH Putative myrosinase 3 OS=Arabidopsis thaliana GN=TGG3 PE=5 SV=1 199 464 8.0E-26
sp|P24240|ASCB_ECOLI 6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) GN=ascB PE=3 SV=2 152 599 1.0E-25
sp|Q8S3J3|HIUH_SOYBN Hydroxyisourate hydrolase OS=Glycine max GN=HIUH PE=1 SV=1 148 443 1.0E-25
sp|Q8WP17|KLOT_MACFA Klotho OS=Macaca fascicularis GN=KL PE=2 SV=1 98 592 2.0E-25
sp|P42403|BGLC_BACSU Aryl-phospho-beta-D-glucosidase BglC OS=Bacillus subtilis (strain 168) GN=bglC PE=1 SV=1 152 609 3.0E-25
sp|Q99N32|KLOTB_MOUSE Beta-klotho OS=Mus musculus GN=Klb PE=1 SV=1 152 595 9.0E-25
sp|P10482|BGLS_CALSA Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus GN=bglA PE=3 SV=1 152 330 1.0E-24
sp|O35082|KLOT_MOUSE Klotho OS=Mus musculus GN=Kl PE=1 SV=2 152 592 5.0E-24
sp|Q9UEF7|KLOT_HUMAN Klotho OS=Homo sapiens GN=KL PE=1 SV=2 152 592 2.0E-23
sp|Q46829|BGLA_ECOLI 6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) GN=bglA PE=1 SV=2 152 324 6.0E-23
sp|Q48409|CASB_KLEOX Phospho-cellobiase OS=Klebsiella oxytoca GN=casB PE=3 SV=1 152 599 1.0E-22
sp|Q9Z2Y9|KLOT_RAT Klotho OS=Rattus norvegicus GN=Kl PE=1 SV=1 152 592 2.0E-22
sp|Q7XSK1|BGL17_ORYSJ Putative beta-glucosidase 17 OS=Oryza sativa subsp. japonica GN=BGLU17 PE=5 SV=3 151 325 3.0E-22
sp|Q9C8K1|BGL36_ARATH Putative myrosinase 6 OS=Arabidopsis thaliana GN=TGG6 PE=5 SV=2 156 589 5.0E-22
sp|B7ECS8|BGL09_ORYSJ Putative beta-glucosidase 9 OS=Oryza sativa subsp. japonica GN=BGLU9 PE=5 SV=2 146 359 1.0E-21
sp|Q6L597|BGL23_ORYSJ Putative beta-glucosidase 23 OS=Oryza sativa subsp. japonica GN=BGLU23 PE=5 SV=2 168 586 2.0E-21
sp|P40740|BGLH_BACSU Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) GN=bglH PE=1 SV=2 152 598 3.0E-20
sp|Q8E4S2|LACG_STRA3 6-phospho-beta-galactosidase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lacG PE=3 SV=1 152 597 3.0E-20
sp|O35082|KLOT_MOUSE Klotho OS=Mus musculus GN=Kl PE=1 SV=2 138 442 4.0E-20
sp|Q9Z2Y9|KLOT_RAT Klotho OS=Rattus norvegicus GN=Kl PE=1 SV=1 138 569 1.0E-19
sp|P11546|LACG_LACLL 6-phospho-beta-galactosidase OS=Lactococcus lactis subsp. lactis GN=lacG PE=1 SV=2 152 597 1.0E-19
sp|Q8WP17|KLOT_MACFA Klotho OS=Macaca fascicularis GN=KL PE=2 SV=1 138 582 2.0E-19
sp|Q99N32|KLOTB_MOUSE Beta-klotho OS=Mus musculus GN=Klb PE=1 SV=1 140 465 2.0E-19
sp|C7N8L9|LACG_LEPBD 6-phospho-beta-galactosidase OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=lacG PE=1 SV=1 152 597 2.0E-19
sp|Q1JK01|LACG_STRPC 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lacG PE=3 SV=1 152 597 3.0E-19
sp|Q1J9V2|LACG_STRPB 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lacG PE=3 SV=1 152 597 3.0E-19
sp|A3CPH0|LACG_STRSV 6-phospho-beta-galactosidase OS=Streptococcus sanguinis (strain SK36) GN=lacG PE=3 SV=1 152 597 5.0E-19
sp|P0DB41|LACG_STRPQ 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lacG PE=3 SV=1 152 597 5.0E-19
sp|P0DB40|LACG_STRP3 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lacG PE=3 SV=1 152 597 5.0E-19
sp|P38645|BGLB_THEBI Thermostable beta-glucosidase B OS=Thermobispora bispora GN=bglB PE=1 SV=1 152 597 6.0E-19
sp|Q1JEZ3|LACG_STRPD 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lacG PE=3 SV=1 152 597 6.0E-19
sp|Q9UEF7|KLOT_HUMAN Klotho OS=Homo sapiens GN=KL PE=1 SV=2 138 569 7.0E-19
sp|Q5X9Y7|LACG_STRP6 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lacG PE=3 SV=1 152 597 8.0E-19
sp|Q97QL9|LACG2_STRPN 6-phospho-beta-galactosidase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lacG2 PE=3 SV=1 152 597 1.0E-18
sp|Q9EV38|LACG_STRGC 6-phospho-beta-galactosidase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lacG PE=3 SV=2 152 597 1.0E-18
sp|Q99Y18|LACG_STRP1 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M1 GN=lacG PE=3 SV=1 152 597 2.0E-18
sp|Q48RC8|LACG_STRPM 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lacG PE=3 SV=1 152 597 2.0E-18
sp|Q8DPP6|LACG2_STRR6 6-phospho-beta-galactosidase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lacG2 PE=3 SV=1 152 597 3.0E-18
sp|Q8CNF8|LACG_STAES 6-phospho-beta-galactosidase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lacG PE=3 SV=1 152 597 3.0E-18
sp|Q5HM41|LACG_STAEQ 6-phospho-beta-galactosidase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lacG PE=3 SV=1 152 597 3.0E-18
sp|C1CEE7|LACG_STRZJ 6-phospho-beta-galactosidase OS=Streptococcus pneumoniae (strain JJA) GN=lacG PE=3 SV=1 152 597 7.0E-18
sp|B8ZQ59|LACG_STRPJ 6-phospho-beta-galactosidase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lacG PE=3 SV=1 152 597 8.0E-18
sp|Q8NZE1|LACG_STRP8 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=lacG PE=3 SV=1 152 597 1.0E-17
sp|A2RGE8|LACG_STRPG 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=lacG PE=3 SV=1 152 597 1.0E-17
sp|B9DU98|LACG_STRU0 6-phospho-beta-galactosidase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lacG PE=3 SV=1 152 597 2.0E-17
sp|Q1J4Q7|LACG_STRPF 6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lacG PE=3 SV=2 152 597 3.0E-17
sp|Q86Z14|KLOTB_HUMAN Beta-klotho OS=Homo sapiens GN=KLB PE=1 SV=1 146 592 4.0E-16
sp|Q59437|BGLA_ENTAG Beta-glucosidase A OS=Enterobacter agglomerans GN=bglA PE=3 SV=1 151 592 5.0E-16
sp|B3W7I3|LACG_LACCB 6-phospho-beta-galactosidase OS=Lactobacillus casei (strain BL23) GN=lacG PE=3 SV=1 152 597 5.0E-16
sp|P14696|LACG_LACCA 6-phospho-beta-galactosidase OS=Lactobacillus casei GN=lacG PE=3 SV=1 152 597 5.0E-16
sp|P67769|LACG_STAAW 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain MW2) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|Q6G7C5|LACG_STAAS 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain MSSA476) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|P67768|LACG_STAAN 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain N315) GN=lacG PE=1 SV=1 152 597 1.0E-15
sp|P67767|LACG_STAAM 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|Q2YYJ9|LACG_STAAB 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|A5IUX8|LACG_STAA9 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain JH9) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|A6U3R9|LACG_STAA2 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain JH1) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|A7X569|LACG_STAA1 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|Q6GEP0|LACG_STAAR 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain MRSA252) GN=lacG PE=3 SV=1 152 597 1.0E-15
sp|P11175|LACG_STAAU 6-phospho-beta-galactosidase OS=Staphylococcus aureus GN=lacG PE=3 SV=1 152 597 3.0E-15
sp|A8YYF6|LACG_STAAT 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lacG PE=3 SV=1 152 597 3.0E-15
sp|A6QJ33|LACG_STAAE 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain Newman) GN=lacG PE=3 SV=1 152 597 3.0E-15
sp|Q2G2D5|LACG_STAA8 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain NCTC 8325) GN=lacG PE=3 SV=1 152 597 3.0E-15
sp|Q2FEU3|LACG_STAA3 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain USA300) GN=lacG PE=3 SV=1 152 597 3.0E-15
sp|Q5HE16|LACG_STAAC 6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain COL) GN=lacG PE=3 SV=1 152 597 3.0E-15
sp|Q8DQZ1|LACG1_STRR6 6-phospho-beta-galactosidase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lacG1 PE=3 SV=1 152 326 6.0E-15
sp|Q97SA9|LACG1_STRPN 6-phospho-beta-galactosidase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lacG1 PE=3 SV=1 152 326 8.0E-15
sp|Q29ZJ1|LACG_LACRH 6-phospho-beta-galactosidase OS=Lactobacillus rhamnosus GN=lacG PE=3 SV=1 152 597 2.0E-14
sp|B4U1G6|LACG_STREM 6-phospho-beta-galactosidase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lacG PE=3 SV=1 152 597 2.0E-14
sp|P50978|LACG_STRMU 6-phospho-beta-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lacG PE=3 SV=2 152 324 3.0E-14
sp|Q4L868|LACG_STAHJ 6-phospho-beta-galactosidase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lacG PE=3 SV=1 152 324 1.0E-13
sp|C0MDS5|LACG_STRS7 6-phospho-beta-galactosidase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lacG PE=3 SV=1 152 597 2.0E-13
sp|O52629|BGAL_PYRWO Beta-galactosidase OS=Pyrococcus woesei PE=1 SV=1 152 592 3.0E-13
sp|P50977|LACG_LACAI 6-phospho-beta-galactosidase OS=Lactobacillus acidophilus GN=lacG PE=3 SV=1 152 382 7.0E-11
sp|Q93Y07|SFR2_ARATH Beta-glucosidase-like SFR2, chloroplastic OS=Arabidopsis thaliana GN=SFR2 PE=1 SV=1 204 329 2.0E-07
sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegicus GN=Lct PE=2 SV=2 201 448 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4833
MRPFWLVVPSLFVAVCSCQLLPRENATQPIYSFKPFTYTTVDTAYATSVSRASRTTRYAAPSQDLISSLLPLISY
TTWGNWDPSATSTATNNDDKDDEYGQAAWTALWERANPPNFTATGLFTATVSPTAIPSSQLVLPPLDAFGPPSGP
DFPAGFIFGVASSAGQIEGAAARDGKAPSALELIIQDARPKNYVTNEFYYYYKQDIERMAAMGVRHFSFSIPWTR
ILPFALPGTPVNQAAIEHYNDMIDFIIEKGMTPIITLLHFDTPLQFFAANLSSVAASGMLGFGNGAYQNQSFPDA
FVNYARIVMAHYADRVPIWFTFNEPLIFSYDARAIDHVLRAHARVYHFYRQELRGTGQVSLKLSNNFGVPRNASS
SADVAAANHFNSFYIATFLNPLVLGTDYPDLFKKTFPNHIALSPQDLAYMKGTVSFISVDMYTATVVSAPVPGRQ
ESILECATNPASPFRPFCVAQSSQNMHGWNIGYRSHSYVYNTPSHFRAYFNYLYNTWRTPLLLAEFGFPVFREGE
KNLPDQLFDSPRSLYYLGVMHAVLQAIWQDGVPVLGALAWSFADDWEFGDYAAQFGLQVVNRTTQQRYYKKSFFD
LVAFMRARGVY*
Coding >OphauB2|4833
ATGAGACCATTTTGGCTGGTTGTTCCGTCTCTTTTCGTGGCCGTTTGCTCGTGTCAGCTCTTGCCACGAGAAAAT
GCCACCCAGCCAATATACTCGTTTAAACCCTTTACCTATACCACTGTAGACACTGCATACGCCACTTCAGTGTCT
CGGGCATCAAGGACAACAAGGTATGCAGCGCCATCGCAAGACTTGATTTCATCACTGCTGCCATTGATATCCTAT
ACAACATGGGGAAACTGGGATCCAAGTGCCACATCCACCGCTACTAATAACGACGACAAGGACGATGAATACGGC
CAAGCTGCCTGGACCGCACTCTGGGAGCGGGCAAACCCCCCCAACTTTACAGCAACAGGCCTCTTTACAGCCACC
GTCTCTCCCACCGCCATCCCCAGCTCTCAACTCGTCCTCCCGCCTTTGGATGCCTTTGGCCCGCCCAGCGGCCCT
GATTTCCCAGCCGGCTTCATCTTTGGAGTGGCAAGTTCAGCCGGCCAAATCGAAGGCGCCGCAGCCCGGGATGGA
AAAGCGCCCTCGGCACTTGAACTCATTATCCAAGACGCACGGCCCAAAAACTATGTAACAAACGAGTTTTACTAC
TACTACAAGCAAGACATTGAGCGCATGGCAGCCATGGGCGTGCGGCACTTTTCCTTTTCTATTCCCTGGACGCGC
ATCTTGCCCTTTGCCCTGCCCGGCACGCCCGTCAACCAGGCTGCCATTGAGCACTACAACGACATGATTGACTTC
ATTATAGAAAAGGGCATGACGCCGATAATTACCCTTTTGCACTTTGACACTCCGCTGCAATTCTTTGCAGCAAAT
CTCTCGTCTGTAGCAGCGAGCGGCATGCTTGGTTTCGGCAACGGCGCTTATCAAAACCAAAGCTTCCCCGATGCC
TTTGTCAATTATGCCCGCATCGTCATGGCGCACTATGCCGACCGGGTGCCCATTTGGTTCACGTTTAACGAGCCG
CTTATATTTTCCTACGACGCGCGTGCCATTGACCACGTTCTGAGGGCACATGCGCGCGTCTACCACTTTTACCGC
CAAGAGCTCAGGGGCACCGGACAGGTGTCGCTCAAGCTGAGCAATAACTTTGGCGTGCCGCGAAATGCAAGCAGC
AGCGCAGATGTGGCAGCGGCAAACCACTTTAACAGTTTCTACATTGCCACCTTTTTGAATCCTCTTGTCCTGGGG
ACTGATTACCCCGACTTGTTTAAAAAGACTTTTCCCAACCACATTGCTCTCAGCCCGCAAGACTTGGCATACATG
AAGGGCACAGTGTCCTTTATCAGCGTCGACATGTACACTGCAACAGTAGTCTCTGCCCCAGTCCCCGGACGCCAA
GAGAGCATTCTCGAGTGTGCCACCAACCCAGCATCCCCATTCCGGCCATTTTGCGTCGCGCAATCCAGCCAAAAC
ATGCACGGCTGGAACATTGGCTACCGCTCCCACTCCTACGTCTACAACACGCCCAGCCATTTCCGCGCCTACTTC
AACTACCTCTACAACACCTGGCGCACACCCCTCCTGCTGGCCGAGTTTGGCTTTCCAGTTTTCCGCGAGGGCGAA
AAGAACCTGCCGGACCAGCTGTTTGACTCGCCGCGCAGCCTCTACTACCTCGGCGTCATGCATGCCGTGCTGCAG
GCCATTTGGCAGGATGGCGTGCCAGTCTTGGGCGCGCTGGCCTGGTCGTTTGCAGATGACTGGGAGTTTGGAGAC
TATGCTGCGCAGTTTGGCCTGCAAGTGGTGAATCGGACGACGCAGCAGCGGTACTACAAGAAGAGCTTTTTTGAC
TTGGTGGCCTTTATGAGAGCCAGGGGGGTATACTAA
Transcript >OphauB2|4833
ATGAGACCATTTTGGCTGGTTGTTCCGTCTCTTTTCGTGGCCGTTTGCTCGTGTCAGCTCTTGCCACGAGAAAAT
GCCACCCAGCCAATATACTCGTTTAAACCCTTTACCTATACCACTGTAGACACTGCATACGCCACTTCAGTGTCT
CGGGCATCAAGGACAACAAGGTATGCAGCGCCATCGCAAGACTTGATTTCATCACTGCTGCCATTGATATCCTAT
ACAACATGGGGAAACTGGGATCCAAGTGCCACATCCACCGCTACTAATAACGACGACAAGGACGATGAATACGGC
CAAGCTGCCTGGACCGCACTCTGGGAGCGGGCAAACCCCCCCAACTTTACAGCAACAGGCCTCTTTACAGCCACC
GTCTCTCCCACCGCCATCCCCAGCTCTCAACTCGTCCTCCCGCCTTTGGATGCCTTTGGCCCGCCCAGCGGCCCT
GATTTCCCAGCCGGCTTCATCTTTGGAGTGGCAAGTTCAGCCGGCCAAATCGAAGGCGCCGCAGCCCGGGATGGA
AAAGCGCCCTCGGCACTTGAACTCATTATCCAAGACGCACGGCCCAAAAACTATGTAACAAACGAGTTTTACTAC
TACTACAAGCAAGACATTGAGCGCATGGCAGCCATGGGCGTGCGGCACTTTTCCTTTTCTATTCCCTGGACGCGC
ATCTTGCCCTTTGCCCTGCCCGGCACGCCCGTCAACCAGGCTGCCATTGAGCACTACAACGACATGATTGACTTC
ATTATAGAAAAGGGCATGACGCCGATAATTACCCTTTTGCACTTTGACACTCCGCTGCAATTCTTTGCAGCAAAT
CTCTCGTCTGTAGCAGCGAGCGGCATGCTTGGTTTCGGCAACGGCGCTTATCAAAACCAAAGCTTCCCCGATGCC
TTTGTCAATTATGCCCGCATCGTCATGGCGCACTATGCCGACCGGGTGCCCATTTGGTTCACGTTTAACGAGCCG
CTTATATTTTCCTACGACGCGCGTGCCATTGACCACGTTCTGAGGGCACATGCGCGCGTCTACCACTTTTACCGC
CAAGAGCTCAGGGGCACCGGACAGGTGTCGCTCAAGCTGAGCAATAACTTTGGCGTGCCGCGAAATGCAAGCAGC
AGCGCAGATGTGGCAGCGGCAAACCACTTTAACAGTTTCTACATTGCCACCTTTTTGAATCCTCTTGTCCTGGGG
ACTGATTACCCCGACTTGTTTAAAAAGACTTTTCCCAACCACATTGCTCTCAGCCCGCAAGACTTGGCATACATG
AAGGGCACAGTGTCCTTTATCAGCGTCGACATGTACACTGCAACAGTAGTCTCTGCCCCAGTCCCCGGACGCCAA
GAGAGCATTCTCGAGTGTGCCACCAACCCAGCATCCCCATTCCGGCCATTTTGCGTCGCGCAATCCAGCCAAAAC
ATGCACGGCTGGAACATTGGCTACCGCTCCCACTCCTACGTCTACAACACGCCCAGCCATTTCCGCGCCTACTTC
AACTACCTCTACAACACCTGGCGCACACCCCTCCTGCTGGCCGAGTTTGGCTTTCCAGTTTTCCGCGAGGGCGAA
AAGAACCTGCCGGACCAGCTGTTTGACTCGCCGCGCAGCCTCTACTACCTCGGCGTCATGCATGCCGTGCTGCAG
GCCATTTGGCAGGATGGCGTGCCAGTCTTGGGCGCGCTGGCCTGGTCGTTTGCAGATGACTGGGAGTTTGGAGAC
TATGCTGCGCAGTTTGGCCTGCAAGTGGTGAATCGGACGACGCAGCAGCGGTACTACAAGAAGAGCTTTTTTGAC
TTGGTGGCCTTTATGAGAGCCAGGGGGGTATACTAA
Gene >OphauB2|4833
ATGAGACCATTTTGGCTGGTTGTTCCGTCTCTTTTCGTGGCCGTTTGCTCGTGTCAGCTCTTGCCACGAGAAAAT
GCCACCCAGCCAATATACTCGTTTAAACCCTTTACCTATACCACTGTAGACACTGCATACGCCACTTCAGTGTCT
CGGGCATCAAGGACAACAAGGTATGCAGCGCCATCGCAAGACTTGATTTCATCACTGCTGCCATTGATATCCTAT
ACAACATGGGGAAACTGGGATCCAAGTGCCACATCCACCGCTACTAATAACGACGACAAGGACGATGAATACGGC
CAAGCTGCCTGGACCGCACTCTGGGAGCGGGCAAACCCCCCCAACTTTACAGCAACAGGCCTCTTTACAGCCACC
GTCTCTCCCACCGCCATCCCCAGCTCTCAACTCGTCCTCCCGCCTTTGGATGCCTTTGGCCCGCCCAGCGGCCCT
GATTTCCCAGCCGGCTTCATCTTTGGAGTGGCAAGTTCAGCCGGCCAAATCGAAGGCGCCGCAGCCCGGGATGGA
AAAGCGCCCTCGGCACTTGAACTCATTATCCAAGACGCACGGCCCAAAAACTATGTAACAAACGAGTTTTACTAC
TACTACAAGCAAGACATTGAGCGCATGGCAGCCATGGGCGTGCGGCACTTTTCCTTTTCTATTCCCTGGACGCGC
ATCTTGCCCTTTGCCCTGCCCGGCACGCCCGTCAACCAGGCTGCCATTGAGCACTACAACGACATGATTGACTTC
ATTATAGAAAAGGGCATGACGCCGATAATTACCCTTTTGCACTTTGACACTCCGCTGCAATTCTTTGCAGCAAAT
CTCTCGTCTGTAGCAGCGAGCGGCATGCTTGGTTTCGGCAACGGCGCTTATCAAAACCAAAGCTTCCCCGATGCC
TTTGTCAATTATGCCCGCATCGTCATGGCGCACTATGCCGACCGGGTGCCCATTTGGTTCACGTTTAACGAGCCG
CTTATATTTTCCTACGACGCGCGTGCCATTGACCACGTTCTGAGGGCACATGCGCGCGTCTACCACTTTTACCGC
CAAGAGCTCAGGGGCACCGGACAGGTGTCGCTCAAGCTGAGCAATAACTTTGGCGTGCCGCGAAATGCAAGCAGC
AGCGCAGATGTGGCAGCGGCAAACCACTTTAACAGTTTCTACATTGCCACCTTTTTGAATCCTCTTGTCCTGGGG
ACTGATTACCCCGACTTGTTTAAAAAGACTTTTCCCAACCACATTGCTCTCAGCCCGCAAGACTTGGCATACATG
AAGGGCACAGTGTCCTTTATCAGCGTCGACATGTACACTGCAACAGTAGTCTCTGCCCCAGTCCCCGGACGCCAA
GAGAGCATTCTCGAGTGTGCCACCAACCCAGCATCCCCATTCCGGCCATTTTGCGTCGCGCAATCCAGCCAAAAC
ATGCACGGCTGGAACATTGGCTACCGCTCCCACTCCTACGTCTACAACACGCCCAGCCATTTCCGCGCCTACTTC
AACTACCTCTACAACACCTGGCGCACACCCCTCCTGCTGGCCGAGTTTGGCTTTCCAGTTTTCCGCGAGGGCGAA
AAGAACCTGCCGGACCAGCTGTTTGACTCGCCGCGCAGCCTCTACTACCTCGGCGTCATGCATGCCGTGCTGCAG
GCCATTTGGCAGGATGGCGTGCCAGTCTTGGGCGCGCTGGCCTGGTCGTTTGCAGATGACTGGGAGTTTGGAGAC
TATGCTGCGCAGTTTGGCCTGCAAGTGGTGAATCGGACGACGCAGCAGCGGTACTACAAGAAGAGCTTTTTTGAC
TTGGTGGCCTTTATGAGAGCCAGGGGGGTATACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail