Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4820
Gene name
LocationContig_339:1450..5416
Strand-
Gene length (bp)3966
Transcript length (bp)3660
Coding sequence length (bp)3660
Protein length (aa) 1220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04053 Coatomer_WDAD Coatomer WD associated region 2.0E-142 352 777
PF06957 COPI_C Coatomer (COPI) alpha subunit C-terminus 4.6E-92 828 1217
PF00400 WD40 WD domain, G-beta repeat 1.5E-05 51 85
PF00400 WD40 WD domain, G-beta repeat 2.2E-07 90 127
PF00400 WD40 WD domain, G-beta repeat 7.6E-06 133 169
PF00400 WD40 WD domain, G-beta repeat 2.6E-04 210 242
PF00400 WD40 WD domain, G-beta repeat 6.5E-05 252 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 7 1218 0.0E+00
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 7 1217 0.0E+00
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 7 1217 0.0E+00
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 7 1217 0.0E+00
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 7 1217 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 7 1218 0.0E+00
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 7 1217 0.0E+00
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 7 1217 0.0E+00
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 7 1217 0.0E+00
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 7 1217 0.0E+00
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 7 1215 0.0E+00
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 7 1215 0.0E+00
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 7 1215 0.0E+00
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 7 1215 0.0E+00
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 7 1215 0.0E+00
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 7 1219 0.0E+00
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 10 822 7.0E-78
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 10 822 8.0E-78
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 10 822 8.0E-78
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 10 868 2.0E-77
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 10 822 2.0E-77
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 10 822 3.0E-77
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 10 822 5.0E-77
sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 10 874 4.0E-76
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 10 777 4.0E-75
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 10 776 6.0E-75
sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 10 776 4.0E-73
sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 10 809 6.0E-73
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec27 PE=3 SV=2 10 795 3.0E-70
sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 10 776 1.0E-69
sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 10 776 5.0E-69
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 10 744 4.0E-67
sp|P41811|COPB2_YEAST Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1 11 782 1.0E-66
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 322 4.0E-36
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 322 1.0E-34
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 300 3.0E-32
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 21 298 9.0E-32
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 322 4.0E-31
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 21 319 6.0E-31
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 3 297 1.0E-30
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 11 325 1.0E-30
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 56 297 1.0E-29
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 3 343 2.0E-29
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 22 322 4.0E-29
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 21 329 4.0E-29
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 18 288 2.0E-28
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 21 322 4.0E-28
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 21 330 6.0E-28
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 56 304 2.0E-27
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 56 297 2.0E-27
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 21 287 2.0E-27
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 21 287 3.0E-27
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 5 361 4.0E-27
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 56 289 5.0E-27
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 5 292 5.0E-27
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 49 328 5.0E-27
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 21 319 7.0E-27
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 56 304 7.0E-27
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 21 287 8.0E-27
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 56 304 8.0E-27
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 56 304 8.0E-27
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 56 304 8.0E-27
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 56 304 8.0E-27
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 56 304 9.0E-27
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 56 332 1.0E-26
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 56 304 1.0E-26
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 56 304 1.0E-26
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 56 304 1.0E-26
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 56 301 1.0E-26
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 56 289 1.0E-26
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 56 304 1.0E-26
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 56 304 2.0E-26
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 56 304 2.0E-26
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 21 287 2.0E-26
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 56 304 3.0E-26
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 56 328 3.0E-26
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 49 328 3.0E-26
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 21 287 5.0E-26
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 56 304 7.0E-26
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 56 297 8.0E-26
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 56 328 8.0E-26
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 21 287 8.0E-26
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 5 289 9.0E-26
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 56 328 9.0E-26
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 56 328 9.0E-26
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 56 328 9.0E-26
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 56 328 1.0E-25
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 56 304 1.0E-25
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 21 287 2.0E-25
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 56 297 2.0E-25
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 71 333 2.0E-25
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 71 333 2.0E-25
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 21 287 2.0E-25
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 21 287 2.0E-25
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 21 287 3.0E-25
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 21 287 3.0E-25
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 48 318 3.0E-25
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 21 287 3.0E-25
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 58 298 4.0E-25
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 21 287 5.0E-25
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 71 321 5.0E-25
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 5 362 6.0E-25
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 21 287 7.0E-25
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 21 287 7.0E-25
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 21 287 7.0E-25
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 21 287 7.0E-25
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 21 287 9.0E-25
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 3 318 9.0E-25
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 21 287 9.0E-25
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 21 287 9.0E-25
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 21 287 9.0E-25
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 21 287 1.0E-24
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 21 287 1.0E-24
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 21 287 1.0E-24
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 21 287 1.0E-24
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 21 287 2.0E-24
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 21 287 2.0E-24
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 71 333 2.0E-24
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 21 287 2.0E-24
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 21 287 3.0E-24
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 21 287 3.0E-24
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 21 354 3.0E-24
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 2 318 3.0E-24
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 21 287 4.0E-24
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 21 287 4.0E-24
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 5 333 5.0E-24
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 56 319 5.0E-24
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 21 287 6.0E-24
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 71 290 7.0E-24
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 38 345 8.0E-24
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 21 287 8.0E-24
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 21 287 9.0E-24
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 37 328 9.0E-24
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 56 289 1.0E-23
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 37 328 1.0E-23
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 71 333 2.0E-23
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 21 287 2.0E-23
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 22 284 2.0E-23
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 71 290 3.0E-23
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 56 304 4.0E-23
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 5 328 4.0E-23
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 21 328 4.0E-23
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 4 244 4.0E-23
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 21 328 5.0E-23
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 5 328 5.0E-23
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 37 328 6.0E-23
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 23 328 6.0E-23
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 21 328 7.0E-23
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 5 328 8.0E-23
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 71 330 8.0E-23
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 21 286 9.0E-23
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 56 319 9.0E-23
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 53 355 9.0E-23
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 56 304 1.0E-22
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 8 244 1.0E-22
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 53 304 1.0E-22
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 10 289 2.0E-22
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 53 355 2.0E-22
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 21 328 2.0E-22
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 56 319 2.0E-22
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 3 170 3.0E-22
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 10 289 4.0E-22
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 56 319 4.0E-22
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 21 328 4.0E-22
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 21 325 5.0E-22
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 11 286 6.0E-22
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 11 286 6.0E-22
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 53 304 7.0E-22
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 48 328 7.0E-22
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 53 357 2.0E-21
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 20 286 2.0E-21
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 23 328 2.0E-21
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 25 282 2.0E-21
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 56 304 3.0E-21
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 22 277 4.0E-21
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 56 304 7.0E-21
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 21 259 8.0E-21
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 53 304 8.0E-21
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 53 304 8.0E-21
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 21 289 9.0E-21
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 10 242 1.0E-20
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 30 289 1.0E-20
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 23 328 1.0E-20
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 3 293 2.0E-20
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 56 297 2.0E-20
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 21 328 2.0E-20
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 42 290 2.0E-20
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 53 304 2.0E-20
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 53 304 2.0E-20
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 11 246 2.0E-20
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 11 246 2.0E-20
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 8 185 3.0E-20
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 5 328 3.0E-20
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 56 327 3.0E-20
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 5 170 4.0E-20
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 5 170 5.0E-20
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 5 170 5.0E-20
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 50 335 5.0E-20
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 21 286 8.0E-20
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 21 286 8.0E-20
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 21 246 8.0E-20
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 53 304 9.0E-20
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 53 304 9.0E-20
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 1 242 1.0E-19
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 5 170 1.0E-19
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 11 286 1.0E-19
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 11 286 2.0E-19
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 28 303 2.0E-19
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 21 246 2.0E-19
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 11 290 2.0E-19
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 53 304 2.0E-19
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 8 286 2.0E-19
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 19 296 2.0E-19
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 53 327 2.0E-19
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 5 170 3.0E-19
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 11 286 3.0E-19
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 21 267 3.0E-19
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 56 327 3.0E-19
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 21 246 4.0E-19
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 53 304 4.0E-19
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 48 333 5.0E-19
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 30 289 5.0E-19
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 53 304 6.0E-19
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 15 170 7.0E-19
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 53 241 7.0E-19
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 53 304 7.0E-19
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 21 286 8.0E-19
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 21 286 8.0E-19
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 21 286 9.0E-19
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 21 286 9.0E-19
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 21 286 9.0E-19
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 60 319 9.0E-19
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 35 297 9.0E-19
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 35 297 9.0E-19
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 70 169 1.0E-18
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 95 333 1.0E-18
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 11 286 1.0E-18
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 56 304 1.0E-18
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 95 333 2.0E-18
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 56 304 2.0E-18
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 38 259 2.0E-18
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 56 290 2.0E-18
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 35 297 2.0E-18
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 35 297 2.0E-18
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 30 297 3.0E-18
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 53 304 3.0E-18
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 11 286 4.0E-18
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 53 304 4.0E-18
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 11 270 4.0E-18
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 52 290 4.0E-18
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 52 290 4.0E-18
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 21 246 4.0E-18
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 21 246 4.0E-18
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 21 327 4.0E-18
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 38 327 4.0E-18
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 43 301 4.0E-18
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 21 259 5.0E-18
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 21 259 5.0E-18
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 38 259 5.0E-18
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 53 304 5.0E-18
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 5 170 6.0E-18
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 45 297 6.0E-18
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 22 328 6.0E-18
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 56 315 6.0E-18
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 21 259 6.0E-18
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 95 333 7.0E-18
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 53 304 7.0E-18
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 21 327 7.0E-18
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 21 246 7.0E-18
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 38 320 7.0E-18
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 19 286 7.0E-18
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 48 327 8.0E-18
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 39 286 9.0E-18
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 53 304 9.0E-18
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 53 304 9.0E-18
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 39 286 1.0E-17
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 38 286 1.0E-17
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 39 272 1.0E-17
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 19 264 1.0E-17
sp|Q9FUY2|LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 65 328 1.0E-17
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 53 304 1.0E-17
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 56 327 1.0E-17
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 38 327 1.0E-17
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 56 327 1.0E-17
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 56 315 1.0E-17
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 5 286 1.0E-17
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 49 319 2.0E-17
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 19 289 2.0E-17
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 19 286 2.0E-17
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 21 321 2.0E-17
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 37 291 2.0E-17
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 39 292 2.0E-17
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 53 304 2.0E-17
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 21 246 3.0E-17
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 19 170 3.0E-17
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 21 266 3.0E-17
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 53 330 3.0E-17
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 38 246 3.0E-17
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 19 286 3.0E-17
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 53 304 3.0E-17
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 21 246 3.0E-17
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 21 266 3.0E-17
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 20 242 4.0E-17
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 38 259 4.0E-17
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 53 314 4.0E-17
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 21 286 4.0E-17
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 53 304 4.0E-17
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 19 321 4.0E-17
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 95 333 5.0E-17
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 21 266 5.0E-17
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 38 246 5.0E-17
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 38 246 6.0E-17
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 38 246 6.0E-17
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 53 290 6.0E-17
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 20 333 6.0E-17
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 12 318 7.0E-17
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 71 328 7.0E-17
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 28 290 7.0E-17
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 11 246 7.0E-17
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 20 312 7.0E-17
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 8 287 8.0E-17
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 49 327 8.0E-17
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 17 253 9.0E-17
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 23 291 9.0E-17
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 39 286 1.0E-16
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 53 332 1.0E-16
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 38 259 1.0E-16
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 38 259 1.0E-16
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 19 286 1.0E-16
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 72 327 1.0E-16
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 54 338 1.0E-16
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 54 338 1.0E-16
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 70 169 2.0E-16
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 94 410 2.0E-16
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 6 327 2.0E-16
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 38 246 2.0E-16
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 38 246 2.0E-16
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 38 246 2.0E-16
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 38 246 2.0E-16
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 38 246 2.0E-16
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 53 304 2.0E-16
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 21 171 3.0E-16
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 49 304 3.0E-16
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 56 322 3.0E-16
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 60 287 3.0E-16
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 60 287 3.0E-16
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 53 319 4.0E-16
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 20 246 4.0E-16
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 20 170 4.0E-16
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 53 304 4.0E-16
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 16 160 4.0E-16
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 16 160 5.0E-16
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 71 328 5.0E-16
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 37 409 6.0E-16
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 21 242 6.0E-16
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 38 289 6.0E-16
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 72 298 6.0E-16
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 21 339 6.0E-16
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 9 126 7.0E-16
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 38 259 7.0E-16
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 54 338 7.0E-16
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 38 246 7.0E-16
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 8 286 8.0E-16
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 54 338 8.0E-16
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 6 148 9.0E-16
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 21 339 9.0E-16
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 54 338 9.0E-16
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 30 286 1.0E-15
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 21 194 1.0E-15
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 39 286 1.0E-15
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 39 286 1.0E-15
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 43 286 1.0E-15
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 20 289 1.0E-15
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 38 259 1.0E-15
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 56 321 1.0E-15
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 72 298 1.0E-15
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 95 355 1.0E-15
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 95 355 1.0E-15
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 10 328 1.0E-15
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 95 355 1.0E-15
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 54 338 1.0E-15
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 54 329 1.0E-15
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 54 338 1.0E-15
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 72 298 1.0E-15
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 8 168 2.0E-15
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 8 168 2.0E-15
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 23 286 2.0E-15
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 19 170 2.0E-15
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 29 246 2.0E-15
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 22 286 2.0E-15
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 54 329 2.0E-15
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 23 303 2.0E-15
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 53 332 2.0E-15
sp|Q8TED0|UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 21 339 2.0E-15
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 46 331 2.0E-15
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 53 334 2.0E-15
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 38 247 2.0E-15
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 43 294 3.0E-15
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 55 322 3.0E-15
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 27 246 3.0E-15
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 53 339 3.0E-15
sp|Q6CGP9|PFS2_YARLI Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1 6 286 3.0E-15
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 30 335 3.0E-15
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 21 362 3.0E-15
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 47 288 3.0E-15
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 38 246 4.0E-15
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 21 325 4.0E-15
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 49 319 5.0E-15
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 49 319 5.0E-15
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 21 169 5.0E-15
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 53 323 5.0E-15
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 38 237 5.0E-15
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 30 298 5.0E-15
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 95 305 6.0E-15
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 19 247 6.0E-15
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 42 429 6.0E-15
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 43 294 7.0E-15
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 95 331 7.0E-15
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 60 319 7.0E-15
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 72 297 7.0E-15
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 38 237 7.0E-15
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 7 286 8.0E-15
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 30 298 8.0E-15
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 5 259 9.0E-15
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 136 330 1.0E-14
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 93 316 1.0E-14
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 94 348 1.0E-14
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 16 286 1.0E-14
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 21 242 1.0E-14
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 37 199 1.0E-14
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 30 329 1.0E-14
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 54 329 1.0E-14
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 72 343 1.0E-14
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 54 329 1.0E-14
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 30 330 1.0E-14
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 35 297 1.0E-14
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 60 327 1.0E-14
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 10 286 1.0E-14
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 60 327 1.0E-14
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 8 286 1.0E-14
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 38 237 1.0E-14
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 72 343 1.0E-14
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 56 327 1.0E-14
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 93 322 2.0E-14
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 3 243 2.0E-14
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 94 341 2.0E-14
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 21 299 2.0E-14
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 29 243 2.0E-14
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 19 211 2.0E-14
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 53 304 2.0E-14
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 53 304 2.0E-14
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 53 304 2.0E-14
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 31 171 2.0E-14
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 31 171 2.0E-14
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 31 171 2.0E-14
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 38 242 2.0E-14
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 38 247 2.0E-14
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 53 304 2.0E-14
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 38 237 2.0E-14
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 60 327 2.0E-14
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 21 169 2.0E-14
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 8 286 2.0E-14
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 60 327 2.0E-14
sp|C4YPI7|LIS1_CANAW Nuclear distribution protein PAC1 OS=Candida albicans (strain WO-1) GN=PAC1 PE=3 SV=1 60 288 2.0E-14
sp|Q5A7Q6|LIS1_CANAL Nuclear distribution protein PAC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAC1 PE=3 SV=1 60 288 2.0E-14
sp|Q8BH57|WDR48_MOUSE WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 60 329 2.0E-14
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 10 286 2.0E-14
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 10 286 2.0E-14
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 10 286 2.0E-14
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 10 286 2.0E-14
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 10 286 2.0E-14
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 3 261 3.0E-14
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 6 129 3.0E-14
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 93 301 3.0E-14
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 38 170 3.0E-14
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 56 312 3.0E-14
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 56 312 3.0E-14
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 30 286 3.0E-14
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 29 253 3.0E-14
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 11 292 3.0E-14
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 93 322 4.0E-14
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 130 325 4.0E-14
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 95 325 4.0E-14
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 53 333 4.0E-14
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 30 291 4.0E-14
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 38 330 4.0E-14
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 72 358 4.0E-14
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 19 327 4.0E-14
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 101 334 4.0E-14
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 14 286 4.0E-14
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 93 356 5.0E-14
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 93 392 5.0E-14
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 17 166 5.0E-14
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 35 170 5.0E-14
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 53 292 5.0E-14
sp|Q5REE0|UTP15_PONAB U3 small nucleolar RNA-associated protein 15 homolog OS=Pongo abelii GN=UTP15 PE=2 SV=1 21 339 5.0E-14
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 23 287 5.0E-14
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 93 356 6.0E-14
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 93 356 6.0E-14
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 93 356 6.0E-14
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 93 356 6.0E-14
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 8 168 6.0E-14
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 93 301 6.0E-14
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 93 301 6.0E-14
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 93 301 6.0E-14
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 93 316 6.0E-14
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 95 392 6.0E-14
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 95 392 6.0E-14
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 37 288 6.0E-14
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 56 312 6.0E-14
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 93 356 7.0E-14
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 71 333 7.0E-14
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 95 329 7.0E-14
sp|Q59WJ4|PFS2_CANAL Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 29 251 7.0E-14
sp|Q6PFM9|WDR48_DANRE WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 60 329 7.0E-14
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 93 319 8.0E-14
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 93 301 8.0E-14
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 93 301 8.0E-14
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 35 170 8.0E-14
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 56 312 8.0E-14
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 19 295 8.0E-14
sp|O54927|WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 14 286 8.0E-14
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 72 392 9.0E-14
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 93 356 9.0E-14
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 93 313 9.0E-14
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 93 301 9.0E-14
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 16 286 9.0E-14
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 37 288 9.0E-14
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 38 297 9.0E-14
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 30 289 9.0E-14
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 10 286 9.0E-14
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 52 304 9.0E-14
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 93 357 1.0E-13
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 93 392 1.0E-13
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 93 356 1.0E-13
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 93 356 1.0E-13
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 93 291 1.0E-13
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 95 389 1.0E-13
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 95 389 1.0E-13
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 30 288 1.0E-13
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 36 340 1.0E-13
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 72 343 1.0E-13
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 10 286 1.0E-13
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 11 244 1.0E-13
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 6 259 1.0E-13
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 72 358 1.0E-13
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 14 293 1.0E-13
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 93 323 2.0E-13
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 93 392 2.0E-13
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 95 287 2.0E-13
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 95 331 2.0E-13
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 128 329 2.0E-13
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 19 168 2.0E-13
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 10 286 2.0E-13
sp|B9WD30|LIS1_CANDC Nuclear distribution protein PAC1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PAC1 PE=3 SV=1 60 288 2.0E-13
sp|Q4R2Z6|WDR48_MACFA WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 60 329 2.0E-13
sp|Q5F3K4|WDR48_CHICK WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 60 329 2.0E-13
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 29 170 2.0E-13
sp|Q5RAW8|WDR48_PONAB WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 60 329 2.0E-13
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 12 186 2.0E-13
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 27 264 2.0E-13
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 19 327 2.0E-13
sp|Q676U5|A16L1_HUMAN Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 53 170 2.0E-13
sp|Q8TAF3|WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 60 329 2.0E-13
sp|Q32PG3|WDR48_BOVIN WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 60 329 2.0E-13
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 21 286 3.0E-13
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 95 315 3.0E-13
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 21 327 3.0E-13
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 95 328 3.0E-13
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 22 172 3.0E-13
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 56 242 3.0E-13
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 34 258 3.0E-13
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 51 329 3.0E-13
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 29 170 3.0E-13
sp|A8ILK1|CFA52_CHLRE Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii GN=CFAP52 PE=1 SV=1 17 290 3.0E-13
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 29 170 3.0E-13
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 56 170 3.0E-13
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 93 301 4.0E-13
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 93 301 4.0E-13
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 93 322 4.0E-13
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 101 319 4.0E-13
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 30 295 4.0E-13
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 19 260 4.0E-13
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 27 249 4.0E-13
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 20 328 4.0E-13
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 46 366 4.0E-13
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 27 249 4.0E-13
sp|Q8C0J2|A16L1_MOUSE Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 53 170 4.0E-13
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 11 171 4.0E-13
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 23 168 5.0E-13
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 7 245 5.0E-13
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 46 366 5.0E-13
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 56 327 5.0E-13
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 27 264 5.0E-13
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 19 242 5.0E-13
sp|A2QP30|LIS1_ASPNC Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 11 269 5.0E-13
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 27 264 5.0E-13
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 93 295 6.0E-13
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 93 295 6.0E-13
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 30 246 6.0E-13
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 27 258 6.0E-13
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 19 170 6.0E-13
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 37 286 6.0E-13
sp|Q5RAC9|A16L1_PONAB Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 53 170 6.0E-13
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 30 241 6.0E-13
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 29 245 6.0E-13
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 23 174 6.0E-13
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 95 301 7.0E-13
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 95 389 7.0E-13
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 30 242 7.0E-13
sp|Q54LT8|STRAP_DICDI Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1 47 286 7.0E-13
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 8 288 7.0E-13
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 6 245 8.0E-13
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 95 392 8.0E-13
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 30 288 8.0E-13
sp|C5MJE8|LIS1_CANTT Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 60 288 8.0E-13
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 30 251 8.0E-13
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 30 251 8.0E-13
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 93 301 9.0E-13
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 6 129 9.0E-13
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 114 330 9.0E-13
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 19 327 9.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 143 1.0E-12
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 130 302 1.0E-12
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 93 313 1.0E-12
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 23 168 1.0E-12
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 93 301 1.0E-12
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 115 324 1.0E-12
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 6 243 1.0E-12
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 15 330 1.0E-12
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 78 331 1.0E-12
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 7 243 1.0E-12
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 29 286 1.0E-12
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 43 331 1.0E-12
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 38 319 1.0E-12
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 53 369 1.0E-12
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 53 309 1.0E-12
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 49 286 1.0E-12
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 30 251 1.0E-12
sp|Q20059|WDR48_CAEEL WD repeat-containing protein 48 homolog OS=Caenorhabditis elegans GN=wdr-48 PE=1 SV=2 72 325 1.0E-12
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 30 305 1.0E-12
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 8 172 1.0E-12
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 23 286 1.0E-12
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 30 251 1.0E-12
sp|O60508|PRP17_HUMAN Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 8 287 1.0E-12
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 19 327 1.0E-12
sp|Q9DC48|PRP17_MOUSE Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1 8 287 1.0E-12
sp|Q5I0B9|ATG16_XENTR Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 47 301 1.0E-12
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 30 251 1.0E-12
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 2 244 1.0E-12
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 130 302 2.0E-12
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 94 407 2.0E-12
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 130 302 2.0E-12
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 130 302 2.0E-12
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 130 302 2.0E-12
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 130 325 2.0E-12
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 6 129 2.0E-12
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 6 129 2.0E-12
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 6 243 2.0E-12
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 13 247 2.0E-12
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 21 173 2.0E-12
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 30 303 2.0E-12
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 30 303 2.0E-12
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 89 319 2.0E-12
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 19 327 2.0E-12
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 45 305 2.0E-12
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 30 298 2.0E-12
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 30 298 2.0E-12
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 19 260 2.0E-12
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 23 168 3.0E-12
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 94 410 3.0E-12
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 94 410 3.0E-12
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 29 182 3.0E-12
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 16 168 3.0E-12
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 72 327 3.0E-12
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 30 288 3.0E-12
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 29 170 3.0E-12
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 10 171 3.0E-12
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 10 171 3.0E-12
sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 44 331 3.0E-12
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 30 298 3.0E-12
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 48 316 3.0E-12
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 27 258 3.0E-12
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 48 301 3.0E-12
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 94 288 4.0E-12
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 11 172 4.0E-12
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 39 178 4.0E-12
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 8 172 4.0E-12
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 48 301 4.0E-12
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 8 172 4.0E-12
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 49 328 4.0E-12
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 95 392 5.0E-12
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 56 294 5.0E-12
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 38 297 5.0E-12
sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 44 331 5.0E-12
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 9 319 5.0E-12
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 130 302 6.0E-12
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 115 324 6.0E-12
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 93 339 6.0E-12
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 18 249 6.0E-12
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 19 168 6.0E-12
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 30 349 6.0E-12
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 30 298 6.0E-12
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 23 286 6.0E-12
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 19 165 6.0E-12
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 94 309 6.0E-12
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 35 170 6.0E-12
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 21 286 6.0E-12
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 27 266 6.0E-12
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 49 286 6.0E-12
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 94 304 7.0E-12
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 19 290 7.0E-12
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 21 168 7.0E-12
sp|A2QP30|LIS1_ASPNC Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 94 290 7.0E-12
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 2 244 7.0E-12
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 23 286 7.0E-12
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 21 319 7.0E-12
sp|P49027|GBLPA_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 47 300 7.0E-12
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 23 168 8.0E-12
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 94 358 8.0E-12
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 56 343 8.0E-12
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 23 283 8.0E-12
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 71 330 8.0E-12
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 2 244 8.0E-12
sp|B0X2V9|WDR48_CULQU WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 54 307 8.0E-12
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 48 332 8.0E-12
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 48 332 8.0E-12
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 48 332 8.0E-12
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 48 332 8.0E-12
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 48 332 8.0E-12
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 48 332 8.0E-12
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 48 332 8.0E-12
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 23 168 9.0E-12
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 94 392 9.0E-12
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 19 178 9.0E-12
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 19 178 9.0E-12
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 60 319 9.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 99 325 1.0E-11
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 188 297 1.0E-11
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 94 358 1.0E-11
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 23 283 1.0E-11
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 22 208 1.0E-11
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 95 342 1.0E-11
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 95 329 1.0E-11
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 23 286 1.0E-11
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 21 171 1.0E-11
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 29 253 1.0E-11
sp|Q75AV4|PFS2_ASHGO Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 9 286 1.0E-11
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 49 286 1.0E-11
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 94 316 1.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 135 318 2.0E-11
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 27 264 2.0E-11
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 27 264 2.0E-11
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 97 297 2.0E-11
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 95 356 2.0E-11
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 95 356 2.0E-11
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 63 327 2.0E-11
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 31 178 2.0E-11
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 18 172 2.0E-11
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 23 283 2.0E-11
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 56 332 2.0E-11
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 38 297 2.0E-11
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 21 170 2.0E-11
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 27 264 2.0E-11
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 9 319 2.0E-11
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 19 263 2.0E-11
sp|Q9T014|SPA2_ARATH Protein SPA1-RELATED 2 OS=Arabidopsis thaliana GN=SPA2 PE=1 SV=2 27 288 2.0E-11
sp|Q652L2|HIRA_ORYSJ Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 56 267 2.0E-11
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 9 319 2.0E-11
sp|Q32LN7|WDR61_BOVIN WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 73 305 2.0E-11
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 27 258 2.0E-11
sp|Q15269|PWP2_HUMAN Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 22 302 2.0E-11
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 73 305 2.0E-11
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 39 178 2.0E-11
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 114 338 3.0E-11
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 90 392 3.0E-11
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 27 264 3.0E-11
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 93 304 3.0E-11
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 55 321 3.0E-11
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 127 297 3.0E-11
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 2 244 3.0E-11
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 2 244 3.0E-11
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 57 297 3.0E-11
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 67 328 3.0E-11
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 2 218 3.0E-11
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 48 316 3.0E-11
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 41 328 3.0E-11
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 53 208 3.0E-11
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 134 297 3.0E-11
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 39 178 3.0E-11
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 71 298 3.0E-11
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 21 325 3.0E-11
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 94 356 4.0E-11
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 38 289 4.0E-11
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 67 326 4.0E-11
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 21 159 4.0E-11
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 38 242 4.0E-11
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 23 168 5.0E-11
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 62 327 5.0E-11
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 95 329 5.0E-11
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 8 169 5.0E-11
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 38 297 5.0E-11
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 38 297 5.0E-11
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 59 297 5.0E-11
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 95 286 5.0E-11
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 73 305 5.0E-11
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 12 250 5.0E-11
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 30 290 5.0E-11
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 42 287 5.0E-11
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 23 203 6.0E-11
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 21 159 6.0E-11
sp|Q59WJ4|PFS2_CANAL Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 21 169 6.0E-11
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 114 302 6.0E-11
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 46 286 6.0E-11
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 94 359 6.0E-11
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 30 335 6.0E-11
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 6 129 7.0E-11
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 188 297 7.0E-11
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 94 333 7.0E-11
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 104 306 7.0E-11
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 15 175 7.0E-11
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 71 311 7.0E-11
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 46 286 7.0E-11
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 84 328 7.0E-11
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 94 333 8.0E-11
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 52 301 8.0E-11
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 52 301 8.0E-11
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 30 335 8.0E-11
sp|A8Q2R5|WDR48_BRUMA WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 56 325 8.0E-11
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 46 286 8.0E-11
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 48 286 8.0E-11
sp|Q9Y2I8|WDR37_HUMAN WD repeat-containing protein 37 OS=Homo sapiens GN=WDR37 PE=1 SV=2 97 335 8.0E-11
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 27 264 9.0E-11
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 6 242 9.0E-11
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 37 171 9.0E-11
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 136 302 1.0E-10
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 137 333 1.0E-10
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 6 129 1.0E-10
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 72 170 1.0E-10
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 91 333 1.0E-10
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 94 356 1.0E-10
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 93 361 1.0E-10
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 95 329 1.0E-10
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 95 329 1.0E-10
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 90 333 1.0E-10
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 95 329 1.0E-10
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 94 289 1.0E-10
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 23 283 1.0E-10
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 134 333 1.0E-10
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 134 333 1.0E-10
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 134 333 1.0E-10
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 57 313 1.0E-10
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 71 298 1.0E-10
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 46 286 1.0E-10
sp|Q8BU03|PWP2_MOUSE Periodic tryptophan protein 2 homolog OS=Mus musculus GN=Pwp2 PE=1 SV=1 22 302 1.0E-10
sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 56 331 1.0E-10
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 46 366 1.0E-10
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 46 286 1.0E-10
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 46 286 1.0E-10
sp|Q5RFQ3|PWP2_PONAB Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 22 296 1.0E-10
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 175 333 2.0E-10
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 6 129 2.0E-10
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 137 328 2.0E-10
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 134 325 2.0E-10
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 17 162 2.0E-10
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 33 286 2.0E-10
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 94 289 2.0E-10
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 83 340 2.0E-10
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 114 302 2.0E-10
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 56 245 2.0E-10
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 14 290 2.0E-10
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 53 328 2.0E-10
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 65 244 2.0E-10
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 67 309 2.0E-10
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 38 178 2.0E-10
sp|Q8CBE3|WDR37_MOUSE WD repeat-containing protein 37 OS=Mus musculus GN=Wdr37 PE=1 SV=1 47 340 2.0E-10
sp|Q9NSI6|BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 56 331 2.0E-10
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 49 328 2.0E-10
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 38 287 2.0E-10
sp|A5DJX5|LIS1_PICGU Nuclear distribution protein PAC1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAC1 PE=3 SV=2 38 245 2.0E-10
sp|Q5F3D7|UTP15_CHICK U3 small nucleolar RNA-associated protein 15 homolog OS=Gallus gallus GN=UTP15 PE=2 SV=1 21 362 2.0E-10
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 38 170 2.0E-10
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 53 316 2.0E-10
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 39 286 3.0E-10
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 93 333 3.0E-10
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 86 297 3.0E-10
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 95 329 3.0E-10
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 19 242 3.0E-10
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 9 169 3.0E-10
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 58 327 3.0E-10
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 114 302 3.0E-10
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 114 302 3.0E-10
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 3 168 3.0E-10
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 114 302 3.0E-10
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 73 288 3.0E-10
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 46 286 3.0E-10
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 37 183 3.0E-10
sp|A8XSW2|WDR48_CAEBR WD repeat-containing protein 48 homolog OS=Caenorhabditis briggsae GN=wdr-48 PE=3 SV=3 56 325 3.0E-10
sp|P40765|COPA_CANLF Coatomer subunit alpha (Fragment) OS=Canis lupus familiaris GN=COPA PE=1 SV=2 7 41 3.0E-10
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 38 246 3.0E-10
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 8 253 3.0E-10
sp|Q09406|A16L2_CAEEL Autophagic-related protein 16.2 OS=Caenorhabditis elegans GN=atg-16.2 PE=3 SV=2 52 174 3.0E-10
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 56 319 3.0E-10
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 94 333 4.0E-10
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 94 356 4.0E-10
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 31 189 4.0E-10
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 85 289 4.0E-10
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 95 329 4.0E-10
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 38 180 4.0E-10
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 21 300 4.0E-10
sp|C4R6H3|LIS1_PICPG Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 26 287 4.0E-10
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 56 319 4.0E-10
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 5 218 4.0E-10
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 30 174 4.0E-10
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 65 244 4.0E-10
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 55 267 4.0E-10
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 53 328 4.0E-10
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 56 286 4.0E-10
sp|Q54W52|WDR12_DICDI Ribosome biogenesis protein WDR12 homolog OS=Dictyostelium discoideum GN=wdr12 PE=2 SV=1 55 360 4.0E-10
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 73 288 4.0E-10
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 38 287 4.0E-10
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 21 194 5.0E-10
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 114 327 5.0E-10
sp|P49027|GBLPA_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 39 178 5.0E-10
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 11 242 5.0E-10
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 10 178 5.0E-10
sp|Q6BIR9|CIAO1_DEBHA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CIA1 PE=3 SV=1 49 287 5.0E-10
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 93 361 6.0E-10
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 30 171 6.0E-10
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 30 171 6.0E-10
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 9 286 6.0E-10
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 59 323 6.0E-10
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 30 168 6.0E-10
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 56 319 6.0E-10
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 93 377 7.0E-10
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 95 347 7.0E-10
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 42 218 7.0E-10
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 29 330 7.0E-10
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 56 289 7.0E-10
sp|Q9SYX2|SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana GN=SPA1 PE=1 SV=1 35 171 7.0E-10
sp|Q5ZL33|STRAP_CHICK Serine-threonine kinase receptor-associated protein OS=Gallus gallus GN=STRAP PE=2 SV=2 47 286 7.0E-10
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 21 319 7.0E-10
sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 64 286 7.0E-10
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 7 243 8.0E-10
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 19 286 8.0E-10
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 50 327 8.0E-10
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 56 319 8.0E-10
sp|Q640J6|WD82A_XENLA WD repeat-containing protein 82-A OS=Xenopus laevis GN=wdr82-a PE=2 SV=1 53 322 8.0E-10
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 30 171 9.0E-10
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 29 330 9.0E-10
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 30 301 9.0E-10
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 56 319 9.0E-10
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 207 333 1.0E-09
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 207 333 1.0E-09
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 207 333 1.0E-09
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 207 333 1.0E-09
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 38 144 1.0E-09
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 136 319 1.0E-09
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 21 170 1.0E-09
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 134 333 1.0E-09
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 39 171 1.0E-09
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 77 349 1.0E-09
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 85 297 1.0E-09
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 30 234 1.0E-09
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 38 297 1.0E-09
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 72 243 1.0E-09
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 45 307 1.0E-09
sp|O94394|YQF1_SCHPO Uncharacterized WD repeat-containing protein C126.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.01c PE=3 SV=2 25 288 1.0E-09
sp|Q5AG86|CIAO1_CANAL Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 5 288 1.0E-09
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 56 319 1.0E-09
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 50 178 1.0E-09
sp|Q9C1X1|PWP2_SCHPO Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1 13 294 1.0E-09
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 38 170 1.0E-09
sp|Q16MY0|WDR48_AEDAE WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 54 307 1.0E-09
sp|Q54J37|STRN_DICDI Striatin homolog OS=Dictyostelium discoideum GN=strn PE=3 SV=1 36 325 1.0E-09
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 56 319 1.0E-09
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 40 356 1.0E-09
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 37 151 2.0E-09
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 21 174 2.0E-09
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 30 171 2.0E-09
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 37 168 2.0E-09
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 55 319 2.0E-09
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 137 406 2.0E-09
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 18 170 2.0E-09
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 76 349 2.0E-09
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 23 175 2.0E-09
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 42 186 2.0E-09
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 136 327 2.0E-09
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 71 280 2.0E-09
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 90 298 2.0E-09
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 20 286 2.0E-09
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 42 218 2.0E-09
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 39 168 2.0E-09
sp|B9WHJ2|CIAO1_CANDC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 49 288 2.0E-09
sp|O94620|CWF17_SCHPO Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 42 289 2.0E-09
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 23 212 3.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 130 324 3.0E-09
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 7 252 3.0E-09
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 9 336 3.0E-09
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 90 298 3.0E-09
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 90 298 3.0E-09
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 37 164 4.0E-09
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 23 212 4.0E-09
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 210 329 4.0E-09
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 127 297 4.0E-09
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 8 186 4.0E-09
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 3 126 5.0E-09
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 7 252 5.0E-09
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 21 171 5.0E-09
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 31 171 5.0E-09
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 38 171 5.0E-09
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 9 174 5.0E-09
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 20 209 5.0E-09
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 3 171 5.0E-09
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 95 309 6.0E-09
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 21 169 6.0E-09
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 38 171 6.0E-09
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 21 190 7.0E-09
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 20 174 8.0E-09
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 118 333 8.0E-09
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 38 126 1.0E-08
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 8 182 1.0E-08
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 77 297 1.0E-08
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 77 297 1.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 23 127 1.0E-08
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 7 247 1.0E-08
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 107 311 1.0E-08
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 92 298 1.0E-08
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 92 298 1.0E-08
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 3 168 1.0E-08
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 114 327 1.0E-08
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 6 246 1.0E-08
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 100 332 1.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 114 322 1.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 114 322 1.0E-08
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 20 168 1.0E-08
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 50 169 1.0E-08
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 50 169 1.0E-08
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 207 333 2.0E-08
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 130 324 2.0E-08
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 137 297 2.0E-08
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 23 173 2.0E-08
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 9 346 2.0E-08
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 133 328 2.0E-08
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 95 309 2.0E-08
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 92 298 2.0E-08
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 21 182 2.0E-08
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 25 253 2.0E-08
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 124 295 2.0E-08
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 32 347 2.0E-08
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 114 343 2.0E-08
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 38 171 2.0E-08
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 38 171 2.0E-08
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 38 171 2.0E-08
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 38 171 2.0E-08
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 38 171 2.0E-08
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 38 171 2.0E-08
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 38 171 2.0E-08
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 56 343 2.0E-08
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 21 290 2.0E-08
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 50 169 2.0E-08
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 21 290 2.0E-08
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 53 325 2.0E-08
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 29 170 2.0E-08
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 50 178 2.0E-08
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 90 298 3.0E-08
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 21 126 3.0E-08
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 7 247 3.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 72 242 3.0E-08
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 32 334 3.0E-08
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 77 297 3.0E-08
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 32 347 3.0E-08
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 77 298 3.0E-08
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 38 162 3.0E-08
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 3 127 3.0E-08
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 21 290 3.0E-08
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 21 290 3.0E-08
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 137 322 4.0E-08
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 133 328 4.0E-08
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 92 298 4.0E-08
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 29 286 4.0E-08
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 136 327 4.0E-08
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 83 311 4.0E-08
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 38 171 4.0E-08
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 50 168 4.0E-08
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 56 287 5.0E-08
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 139 306 5.0E-08
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 56 335 5.0E-08
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 136 327 5.0E-08
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 90 298 5.0E-08
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 12 243 5.0E-08
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 77 297 6.0E-08
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 77 297 7.0E-08
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 95 329 8.0E-08
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 204 452 8.0E-08
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 114 327 8.0E-08
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 7 242 8.0E-08
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 208 327 9.0E-08
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 29 329 9.0E-08
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 208 492 1.0E-07
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 53 338 1.0E-07
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 137 372 1.0E-07
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 59 329 1.0E-07
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 3 171 1.0E-07
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 39 169 1.0E-07
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 93 247 1.0E-07
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 21 169 1.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 56 337 1.0E-07
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 21 169 1.0E-07
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 132 327 1.0E-07
sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 53 216 1.0E-07
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 21 290 1.0E-07
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 208 327 2.0E-07
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 8 135 2.0E-07
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 7 288 2.0E-07
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 21 194 2.0E-07
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 21 169 2.0E-07
sp|Q32LN7|WDR61_BOVIN WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 21 169 2.0E-07
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 3 168 2.0E-07
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 21 168 2.0E-07
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 94 334 2.0E-07
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 38 243 2.0E-07
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 12 243 2.0E-07
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 71 168 3.0E-07
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 95 297 3.0E-07
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 3 168 3.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 21 127 3.0E-07
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 6 245 3.0E-07
sp|A8Q2R5|WDR48_BRUMA WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 73 298 3.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 12 168 3.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 50 178 3.0E-07
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 21 169 3.0E-07
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 8 135 4.0E-07
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 3 126 4.0E-07
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 127 321 4.0E-07
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 127 321 4.0E-07
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 95 297 4.0E-07
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 54 286 4.0E-07
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 52 168 4.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 50 168 4.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 50 168 4.0E-07
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 140 319 5.0E-07
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 140 319 5.0E-07
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 8 207 5.0E-07
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 8 207 5.0E-07
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 95 297 5.0E-07
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 53 175 5.0E-07
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 93 247 5.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 52 168 5.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 12 168 5.0E-07
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 21 127 6.0E-07
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 7 242 6.0E-07
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 20 171 7.0E-07
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 20 171 7.0E-07
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 30 323 7.0E-07
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 142 387 7.0E-07
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 68 242 8.0E-07
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 8 207 9.0E-07
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 21 127 9.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 21 126 9.0E-07
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 18 84 1.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 18 84 1.0E-06
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 140 322 1.0E-06
sp|Q8TED0|UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 8 207 1.0E-06
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 209 352 1.0E-06
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 209 352 1.0E-06
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 209 352 1.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 38 206 1.0E-06
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 21 207 1.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 72 243 1.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 72 243 1.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 72 243 1.0E-06
sp|Q32LN7|WDR61_BOVIN WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 21 207 1.0E-06
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 21 207 1.0E-06
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 72 243 1.0E-06
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 11 170 1.0E-06
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 21 127 2.0E-06
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 3 126 2.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 30 168 2.0E-06
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 7 127 2.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 209 352 2.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 72 243 2.0E-06
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 8 244 2.0E-06
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 17 290 2.0E-06
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 56 245 2.0E-06
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 21 243 2.0E-06
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 18 195 2.0E-06
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 208 311 3.0E-06
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 208 311 3.0E-06
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 208 311 3.0E-06
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 208 311 3.0E-06
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 208 311 3.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 208 311 3.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 208 311 3.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 208 327 3.0E-06
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 21 132 3.0E-06
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 193 346 3.0E-06
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 20 264 3.0E-06
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 133 297 3.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 94 297 3.0E-06
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 11 170 3.0E-06
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 17 225 3.0E-06
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 134 367 3.0E-06
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 8 170 3.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 208 311 4.0E-06
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 208 311 4.0E-06
sp|Q59WJ4|PFS2_CANAL Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 87 297 4.0E-06
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 8 170 4.0E-06
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 21 184 5.0E-06
sp|Q676U5|A16L1_HUMAN Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 134 329 5.0E-06
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 11 170 5.0E-06
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 27 168 6.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 2 127 7.0E-06
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 21 325 7.0E-06
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 16 325 7.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 8 127 7.0E-06
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 21 207 7.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 208 311 8.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 8 127 8.0E-06
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 8 170 1.0E-05
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 8 170 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0030126 COPI vesicle coat Yes
GO:0030117 membrane coat Yes
GO:0005515 protein binding Yes
GO:0005198 structural molecule activity Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0045184 establishment of protein localization No
GO:0005488 binding No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0033036 macromolecule localization No
GO:0030120 vesicle coat No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0098796 membrane protein complex No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4820
MQSSPGMLTKFESKSSRAKGIAFHPKRPWILVALHSSTIQLWDYRMGTLIDRFEEHDGPVRGVDFHPTQPLFVSG
GDDYKVKVWSYQTRRCLFTLNGHLDYVRTVFFHHELPWILSSSDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFH
PKDDLVVSASLDQSVRVWDISGLRKKHSAPTSMNFEDQMARTNQNQADVFGNTDAIVKFVLEGHDRGVNWVAFHP
SMPLIVSAGDDRLVKLWRMSETKAWEVDTCRGHFHNASGCLFHPHQDLILSAGEDKTIRVWDLNKRTAVQTFKRE
HDRFWVIAAHPEINLFAAGHDNGVMVFKLERERPASATYQNTLFYITKDKLVKSYDFVKNVENPALLSLKKLGNP
WITPRTLSYNPAERSVLVTTPADGGSYELVNLPKGSGVIEPTEVKRGPGNSAIFVARNRFAVLDLSNQTIDIKDL
SNNTTRSFKPPAGTSDIYFGGTGTLLIITPTAVHLYDIQQKKSTAELTVNGVKYVVWSNDGLYAALLSKHNVTIV
TKSLEQVSSLHETIRIKSAAWDDAGVLLYSTLNHVKYTLLNGDNGIVRTLDQTVYLVRIKGRSVYCLDRAAKPRI
LQIDPTEYRFKLALVKRNYEEMLHIIRTSSLVGQSIISYLQKKGYPEIALQFVQDPTTRFDLAIECGNLDVAVEM
AKELDKPKFWARLATESLSHGHQQIVEMCYQKLKQFDKLSFLYLATGDYSKLARMAKIAEHRGDYTSRFHNTLYL
GEVGDRIQMLKEIDLYPLAYMTAKSHGLEDECQAILAAADLGEDQLIMPTLGTPLAPPKPIVSTYKSKWPTKANS
QSFFEMALLGQVEGLSLEDEPTGGERGELENGSLADAASKGNGDPDDDDVDVAGWDLGPDLIAGAEGDSMNVAST
ESGKAGSSEADLWARNSPLAVDHVAGGSFDTAMQLLNRQVGAVNFMPLKSRFLEVFQASKTFLPALPSMPSLTNY
VRRTTEEMDSRHVLPAIPRDLEHLAANELQKGYDAMKANKLEHGIETFRGILHCILVNAVSSEDEVAEAKKLVTS
ACEYVVAMSIELARRRLGRPEAVVENPSMLKRSLELSAYFTIPKIEVPHRQLALLSAMQLAIKSKNFNSALSFAN
RIIANGGSSKIIESAKRTKLQCERNPNDALDIEFDQFAEFDICAASHTPIYSGTPFEECAFDGSKYHTKFKGTAC
TVCQVCEVGKLGSGLKLLT*
Coding >OphauB2|4820
ATGCAGTCCTCGCCGGGCATGCTGACCAAGTTTGAGTCCAAGTCATCCAGAGCAAAGGGAATTGCTTTCCACCCC
AAGCGACCATGGATCCTTGTCGCCCTTCATTCATCCACCATTCAGCTTTGGGACTATCGTATGGGCACTTTGATT
GATCGATTTGAGGAGCATGATGGCCCTGTTCGTGGCGTCGACTTCCACCCAACACAACCCCTATTCGTCTCTGGT
GGGGACGATTACAAGGTTAAGGTCTGGTCCTACCAGACTCGTCGATGTCTCTTCACCCTAAACGGACATCTCGAT
TACGTTCGTACCGTCTTTTTTCACCATGAACTGCCGTGGATACTATCATCGTCTGATGATCAAACTATTCGAATA
TGGAATTGGCAGAACCGTTCCCTAATCTGCACCATGACTGGCCATAACCACTATGTCATGTGCGCCCAATTTCAT
CCAAAAGATGATCTCGTTGTCTCGGCTTCGCTGGATCAATCTGTTAGAGTTTGGGATATCTCTGGCCTTCGCAAG
AAACACTCTGCGCCAACTTCCATGAATTTTGAAGATCAAATGGCTCGAACCAACCAGAATCAGGCTGACGTCTTT
GGTAATACTGATGCTATCGTCAAGTTCGTACTCGAGGGTCATGATCGTGGTGTTAATTGGGTTGCATTTCACCCA
TCAATGCCTCTCATCGTTTCTGCCGGCGATGATCGCCTTGTCAAGCTCTGGCGTATGAGCGAAACAAAGGCATGG
GAAGTGGATACCTGCCGGGGTCATTTCCACAATGCGTCTGGTTGTTTGTTCCATCCCCACCAGGACCTCATTCTC
TCGGCAGGTGAAGACAAGACGATTCGAGTATGGGACCTCAATAAGCGTACTGCTGTTCAAACTTTCAAGAGAGAG
CATGATCGATTCTGGGTGATTGCAGCCCATCCCGAGATTAATCTTTTCGCTGCAGGTCACGACAATGGGGTTATG
GTTTTCAAATTAGAACGCGAGCGCCCTGCTTCGGCTACTTATCAGAATACGCTATTCTACATCACGAAGGACAAG
TTGGTCAAGTCTTACGACTTTGTAAAGAACGTTGAGAATCCAGCTCTACTATCTCTTAAGAAGCTGGGTAACCCT
TGGATCACGCCACGAACCTTGTCATATAACCCCGCGGAGCGCTCCGTCTTAGTCACAACGCCGGCGGATGGAGGA
TCATATGAGCTTGTTAATCTCCCTAAGGGATCTGGAGTTATTGAGCCAACTGAGGTGAAGCGTGGGCCTGGAAAC
TCAGCCATTTTCGTCGCCAGAAATCGCTTTGCAGTCCTTGACTTGTCAAATCAAACCATTGACATCAAAGATTTG
TCCAATAACACTACACGATCTTTCAAACCGCCAGCTGGGACGTCCGATATTTACTTTGGCGGCACTGGCACCCTT
CTCATCATCACACCTACTGCCGTCCATCTCTATGACATTCAGCAAAAGAAGAGCACAGCGGAGTTGACTGTTAAC
GGCGTCAAATACGTTGTGTGGTCTAATGACGGGCTCTACGCTGCGTTGCTCAGCAAACACAATGTAACCATTGTG
ACAAAAAGTCTGGAACAAGTTAGTAGCCTTCACGAGACTATCAGGATCAAGAGTGCTGCGTGGGATGATGCCGGC
GTGCTCCTATACTCAACATTGAATCACGTCAAGTATACTTTACTTAATGGCGATAATGGCATTGTGCGAACACTC
GACCAGACCGTGTACTTGGTACGGATCAAAGGCCGCAGTGTCTACTGCCTCGATCGCGCTGCCAAGCCTCGAATT
CTGCAGATTGACCCTACAGAATATCGATTCAAATTAGCTCTGGTTAAGAGGAACTATGAAGAGATGCTACACATC
ATTCGTACCTCGAGTCTCGTTGGCCAGTCCATCATATCCTATCTGCAGAAGAAAGGGTATCCGGAGATTGCTTTG
CAATTTGTCCAAGATCCAACCACGCGTTTTGACTTGGCAATTGAGTGCGGAAACCTTGACGTTGCGGTCGAAATG
GCTAAAGAATTGGATAAACCTAAGTTCTGGGCGCGATTGGCAACGGAATCCTTGTCCCATGGCCACCAACAGATT
GTGGAAATGTGTTACCAAAAGCTAAAGCAATTTGATAAGCTATCGTTTCTCTATCTCGCGACTGGAGACTACTCA
AAGCTTGCCAGGATGGCCAAAATTGCCGAACACCGTGGCGACTACACGTCACGCTTTCACAATACTCTGTACCTT
GGCGAGGTTGGTGATCGTATCCAGATGCTCAAGGAAATTGATCTCTACCCTCTTGCTTATATGACGGCGAAGTCA
CATGGTTTAGAAGATGAATGCCAAGCTATATTGGCAGCTGCTGACTTGGGTGAAGATCAATTGATCATGCCGACG
CTTGGAACTCCTCTCGCTCCGCCAAAGCCCATAGTGTCAACTTACAAGAGCAAATGGCCCACAAAGGCAAACTCG
CAGTCTTTTTTTGAAATGGCGCTTCTTGGGCAGGTGGAAGGGTTGTCTCTCGAAGACGAACCCACGGGTGGTGAA
AGAGGGGAATTGGAGAATGGCTCGCTTGCTGATGCCGCCAGCAAAGGCAACGGCGATCCTGATGACGACGATGTC
GATGTTGCCGGCTGGGACCTGGGTCCCGATCTCATAGCCGGAGCCGAGGGCGATTCGATGAATGTGGCAAGCACT
GAATCCGGGAAAGCTGGAAGCAGCGAAGCAGATCTTTGGGCCCGAAACTCGCCTCTGGCTGTTGATCATGTTGCC
GGCGGCTCCTTTGACACGGCCATGCAGCTTTTGAACCGCCAAGTCGGGGCTGTCAACTTTATGCCTCTCAAGTCT
CGTTTCCTGGAGGTATTCCAAGCATCGAAGACATTTTTACCTGCTTTACCTAGTATGCCCTCTTTGACCAACTAT
GTGCGCCGCACCACGGAAGAGATGGACTCTCGCCACGTACTGCCCGCTATTCCCCGCGATCTGGAGCATCTGGCC
GCGAACGAACTGCAAAAAGGCTATGACGCGATGAAGGCAAACAAGCTGGAGCACGGGATTGAAACCTTCAGGGGT
ATTTTGCATTGCATTCTCGTCAATGCCGTATCTAGCGAGGATGAAGTGGCCGAAGCAAAAAAACTTGTCACTTCA
GCATGCGAGTATGTGGTGGCAATGAGCATTGAGCTCGCACGAAGACGGCTTGGACGTCCTGAAGCTGTGGTTGAA
AACCCATCGATGCTCAAGAGGAGTCTCGAATTGTCGGCGTACTTTACCATTCCCAAGATCGAAGTGCCACACAGA
CAGCTGGCCCTATTGAGCGCTATGCAGCTAGCCATTAAAAGCAAAAACTTCAATTCAGCTCTGAGCTTTGCCAAT
CGAATCATTGCAAATGGCGGCTCTAGCAAGATCATTGAGAGTGCAAAGAGAACGAAGCTTCAGTGCGAGCGAAAT
CCCAATGACGCTCTGGATATCGAATTTGACCAATTCGCTGAGTTCGACATTTGCGCCGCCAGTCACACACCAATT
TACAGTGGCACACCATTTGAGGAATGCGCATTTGACGGGTCAAAGTATCACACCAAATTCAAGGGTACGGCGTGT
ACAGTGTGCCAAGTATGCGAGGTTGGTAAGCTTGGAAGTGGGTTAAAACTCTTGACTTGA
Transcript >OphauB2|4820
ATGCAGTCCTCGCCGGGCATGCTGACCAAGTTTGAGTCCAAGTCATCCAGAGCAAAGGGAATTGCTTTCCACCCC
AAGCGACCATGGATCCTTGTCGCCCTTCATTCATCCACCATTCAGCTTTGGGACTATCGTATGGGCACTTTGATT
GATCGATTTGAGGAGCATGATGGCCCTGTTCGTGGCGTCGACTTCCACCCAACACAACCCCTATTCGTCTCTGGT
GGGGACGATTACAAGGTTAAGGTCTGGTCCTACCAGACTCGTCGATGTCTCTTCACCCTAAACGGACATCTCGAT
TACGTTCGTACCGTCTTTTTTCACCATGAACTGCCGTGGATACTATCATCGTCTGATGATCAAACTATTCGAATA
TGGAATTGGCAGAACCGTTCCCTAATCTGCACCATGACTGGCCATAACCACTATGTCATGTGCGCCCAATTTCAT
CCAAAAGATGATCTCGTTGTCTCGGCTTCGCTGGATCAATCTGTTAGAGTTTGGGATATCTCTGGCCTTCGCAAG
AAACACTCTGCGCCAACTTCCATGAATTTTGAAGATCAAATGGCTCGAACCAACCAGAATCAGGCTGACGTCTTT
GGTAATACTGATGCTATCGTCAAGTTCGTACTCGAGGGTCATGATCGTGGTGTTAATTGGGTTGCATTTCACCCA
TCAATGCCTCTCATCGTTTCTGCCGGCGATGATCGCCTTGTCAAGCTCTGGCGTATGAGCGAAACAAAGGCATGG
GAAGTGGATACCTGCCGGGGTCATTTCCACAATGCGTCTGGTTGTTTGTTCCATCCCCACCAGGACCTCATTCTC
TCGGCAGGTGAAGACAAGACGATTCGAGTATGGGACCTCAATAAGCGTACTGCTGTTCAAACTTTCAAGAGAGAG
CATGATCGATTCTGGGTGATTGCAGCCCATCCCGAGATTAATCTTTTCGCTGCAGGTCACGACAATGGGGTTATG
GTTTTCAAATTAGAACGCGAGCGCCCTGCTTCGGCTACTTATCAGAATACGCTATTCTACATCACGAAGGACAAG
TTGGTCAAGTCTTACGACTTTGTAAAGAACGTTGAGAATCCAGCTCTACTATCTCTTAAGAAGCTGGGTAACCCT
TGGATCACGCCACGAACCTTGTCATATAACCCCGCGGAGCGCTCCGTCTTAGTCACAACGCCGGCGGATGGAGGA
TCATATGAGCTTGTTAATCTCCCTAAGGGATCTGGAGTTATTGAGCCAACTGAGGTGAAGCGTGGGCCTGGAAAC
TCAGCCATTTTCGTCGCCAGAAATCGCTTTGCAGTCCTTGACTTGTCAAATCAAACCATTGACATCAAAGATTTG
TCCAATAACACTACACGATCTTTCAAACCGCCAGCTGGGACGTCCGATATTTACTTTGGCGGCACTGGCACCCTT
CTCATCATCACACCTACTGCCGTCCATCTCTATGACATTCAGCAAAAGAAGAGCACAGCGGAGTTGACTGTTAAC
GGCGTCAAATACGTTGTGTGGTCTAATGACGGGCTCTACGCTGCGTTGCTCAGCAAACACAATGTAACCATTGTG
ACAAAAAGTCTGGAACAAGTTAGTAGCCTTCACGAGACTATCAGGATCAAGAGTGCTGCGTGGGATGATGCCGGC
GTGCTCCTATACTCAACATTGAATCACGTCAAGTATACTTTACTTAATGGCGATAATGGCATTGTGCGAACACTC
GACCAGACCGTGTACTTGGTACGGATCAAAGGCCGCAGTGTCTACTGCCTCGATCGCGCTGCCAAGCCTCGAATT
CTGCAGATTGACCCTACAGAATATCGATTCAAATTAGCTCTGGTTAAGAGGAACTATGAAGAGATGCTACACATC
ATTCGTACCTCGAGTCTCGTTGGCCAGTCCATCATATCCTATCTGCAGAAGAAAGGGTATCCGGAGATTGCTTTG
CAATTTGTCCAAGATCCAACCACGCGTTTTGACTTGGCAATTGAGTGCGGAAACCTTGACGTTGCGGTCGAAATG
GCTAAAGAATTGGATAAACCTAAGTTCTGGGCGCGATTGGCAACGGAATCCTTGTCCCATGGCCACCAACAGATT
GTGGAAATGTGTTACCAAAAGCTAAAGCAATTTGATAAGCTATCGTTTCTCTATCTCGCGACTGGAGACTACTCA
AAGCTTGCCAGGATGGCCAAAATTGCCGAACACCGTGGCGACTACACGTCACGCTTTCACAATACTCTGTACCTT
GGCGAGGTTGGTGATCGTATCCAGATGCTCAAGGAAATTGATCTCTACCCTCTTGCTTATATGACGGCGAAGTCA
CATGGTTTAGAAGATGAATGCCAAGCTATATTGGCAGCTGCTGACTTGGGTGAAGATCAATTGATCATGCCGACG
CTTGGAACTCCTCTCGCTCCGCCAAAGCCCATAGTGTCAACTTACAAGAGCAAATGGCCCACAAAGGCAAACTCG
CAGTCTTTTTTTGAAATGGCGCTTCTTGGGCAGGTGGAAGGGTTGTCTCTCGAAGACGAACCCACGGGTGGTGAA
AGAGGGGAATTGGAGAATGGCTCGCTTGCTGATGCCGCCAGCAAAGGCAACGGCGATCCTGATGACGACGATGTC
GATGTTGCCGGCTGGGACCTGGGTCCCGATCTCATAGCCGGAGCCGAGGGCGATTCGATGAATGTGGCAAGCACT
GAATCCGGGAAAGCTGGAAGCAGCGAAGCAGATCTTTGGGCCCGAAACTCGCCTCTGGCTGTTGATCATGTTGCC
GGCGGCTCCTTTGACACGGCCATGCAGCTTTTGAACCGCCAAGTCGGGGCTGTCAACTTTATGCCTCTCAAGTCT
CGTTTCCTGGAGGTATTCCAAGCATCGAAGACATTTTTACCTGCTTTACCTAGTATGCCCTCTTTGACCAACTAT
GTGCGCCGCACCACGGAAGAGATGGACTCTCGCCACGTACTGCCCGCTATTCCCCGCGATCTGGAGCATCTGGCC
GCGAACGAACTGCAAAAAGGCTATGACGCGATGAAGGCAAACAAGCTGGAGCACGGGATTGAAACCTTCAGGGGT
ATTTTGCATTGCATTCTCGTCAATGCCGTATCTAGCGAGGATGAAGTGGCCGAAGCAAAAAAACTTGTCACTTCA
GCATGCGAGTATGTGGTGGCAATGAGCATTGAGCTCGCACGAAGACGGCTTGGACGTCCTGAAGCTGTGGTTGAA
AACCCATCGATGCTCAAGAGGAGTCTCGAATTGTCGGCGTACTTTACCATTCCCAAGATCGAAGTGCCACACAGA
CAGCTGGCCCTATTGAGCGCTATGCAGCTAGCCATTAAAAGCAAAAACTTCAATTCAGCTCTGAGCTTTGCCAAT
CGAATCATTGCAAATGGCGGCTCTAGCAAGATCATTGAGAGTGCAAAGAGAACGAAGCTTCAGTGCGAGCGAAAT
CCCAATGACGCTCTGGATATCGAATTTGACCAATTCGCTGAGTTCGACATTTGCGCCGCCAGTCACACACCAATT
TACAGTGGCACACCATTTGAGGAATGCGCATTTGACGGGTCAAAGTATCACACCAAATTCAAGGGTACGGCGTGT
ACAGTGTGCCAAGTATGCGAGGTTGGTAAGCTTGGAAGTGGGTTAAAACTCTTGACTTGA
Gene >OphauB2|4820
ATGCAGTCCTCGCCGGGCATGCTGACCAAGGTATGTCAAGCAATTGCTTTCCCTCATTTGATGGTTGATGCACTA
ATAGCTGTCTAGTTTGAGTCCAAGTCATCCAGAGCAAAGGGAATTGCTTTCCACCCCAAGCGGTAGTCCTCCGAG
TTTCCTCATGCAATGGTCCTCCACACCCAGTCACTAATGAGTCTGTAGACCATGGATCCTTGTCGCCCTTCATTC
ATCCACCATTCAGCTTTGGGACTATCGTATGGGCACTTTGATTGATCGATTTGAGGAGCATGATGGCCCTGTTCG
TGGCGTCGACTTCCACCCAACACAACCCCTATTCGTCTCTGGTGGGGACGATTACAAGGTTAAGGTCTGGTCCTA
CCAGACTCGTCGATGTCTCTTCACCCTAAACGGACATCTCGATTACGTTCGTACCGTCTTTTTTCACCATGAACT
GCCGTGGATACTATCATCGTCTGATGATCAAACTATTCGAATATGGAATTGGCAGAACCGTTCCCTAAGTCTGTC
GTCCAGCATTTGCTTCTTTGCCCGCTCCTTGACTAATGCTGACTACCTATAAAGTCTGCACCATGACTGGCCATA
ACCACTATGTCATGTGCGCCCAATTTCATCCAAAAGATGATCTCGTTGTCTCGGCTTCGCTGGATCAATCTGTTA
GAGTTTGGGATATCTCTGGCCTTCGCAAGAAACACTCTGCGCCAACTTCCATGAATTTTGAAGATCAAATGGCTC
GAACCAACCAGAATCAGGCTGACGTCTTTGGTAATACTGATGCTATCGTCAAGTTCGTACTCGAGGGTCATGATC
GTGGTGTTAATTGGGTTGCATTTCACCCATCAATGCCTCTCATCGTTTCTGCCGGCGATGATCGCCTTGTCAAGC
TCTGGCGTATGAGCGAAACAAAGGCATGGGAAGTGGATACCTGCCGGGGTCATTTCCACAATGCGTCTGGTTGTT
TGTTCCATCCCCACCAGGACCTCATTCTCTCGGCAGGTGAAGACAAGACGATTCGAGTATGGGACCTCAATAAGC
GTACTGCTGTTCAAACTTTCAAGAGAGAGCATGATCGATTCTGGGTGATTGCAGCCCATCCCGAGATTAATCTTT
TCGCTGCAGGTCACGACAATGGGGTTATGGTTTTCAAATTAGAACGCGAGCGCCCTGCTTCGGCTACTTATCAGA
ATACGCTATTCTACATCACGAAGGACAAGTTGGTCAAGTCTTACGACTTTGTAAAGAACGTTGAGAATCCAGCTC
TACTATCTCTTAAGAAGCTGGGTAACCCTTGGATCACGCCACGAACCTTGTCATATAACCCCGCGGAGCGCTCCG
TCTTAGTCACAACGCCGGCGGATGGAGGATCATATGAGCTTGTTAATCTCCCTAAGGGATCTGGAGTTATTGAGC
CAACTGAGGTGAAGCGTGGGCCTGGAAACTCAGCCATTTTCGTCGCCAGAAATCGCTTTGCAGTCCTTGACTTGT
CAAATCAAACCATTGACATCAAAGATTTGTCCAATAACACTACACGATCTTTCAAACCGCCAGCTGGGACGTCCG
ATATTTACTTTGGCGGCACTGGCACCCTTCTCATCATCACACCTACTGCCGTCCATCTCTATGACATTCAGCAAA
AGAAGAGCACAGCGGAGTTGACTGTTAACGGCGTCAAATACGTTGTGTGGTCTAATGACGGGCTCTACGCTGCGT
TGCTCAGCAAACACAATGTAACCATTGTGACAAAAAGTCTGGAACAAGTTAGTAGCCTTCACGAGACTATCAGGA
TCAAGAGTGCTGCGTGGGATGATGCCGGCGTGCTCCTATACTCAACATTGAATCACGTCAAGTATACTTTACTTA
ATGGCGATAATGGCATTGTGCGAACACTCGACCAGACCGTGTACTTGGTACGGATCAAAGGCCGCAGTGTCTACT
GCCTCGATCGCGCTGCCAAGCCTCGAATTCTGCAGATTGACCCTACAGAATATCGATTCAAATTAGCTCTGGTTA
AGAGGAACTATGAAGAGATGCTACACATCATTCGTACCTCGAGTCTCGTTGGCCAGTCCATCATATCCTATCTGC
AGAAGAAAGGGTATCCGGAGATTGCTTTGCAATTTGTCCAAGATCCAACCACGCGTTTTGACTTGGCAATTGAGT
GCGGAAACCTTGACGTTGCGGTCGAAATGGCTAAAGAATTGGATAAACCTAAGTTCTGGGCGCGATTGGCAACGG
AATCCTTGTCCCATGGCCACCAACAGATTGTGGAAATGTGTTACCAAAAGCTAAAGCAATTTGATAAGCTATCGT
TTCTCTATCTCGCGACTGGAGACTACTCAAAGCTTGCCAGGATGGCCAAAATTGCCGAACACCGTGGCGACTACA
CGTCACGCTTTCACAATACTCTGTACCTTGGCGAGGTTGGTGATCGTATCCAGATGCTCAAGGAAATTGATCTCT
GTCAGTTCTCATCTTTGCTGCCTTTAGGAAGGATTCTGACCGTACGCTACAGACCCTCTTGCTTATATGACGGCG
AAGTCACATGGTTTAGAAGATGAATGCCAAGCTATATTGGCAGCTGCTGACTTGGGTGAAGATCAATTGATCATG
CCGACGCTTGGAACTCCTCTCGCTCCGCCAAAGCCCATAGTGTCAACTTACAAGAGCAAATGGCCCACAAAGGCA
AACTCGCAGTCTTTTTTTGAAATGGCGCTTCTTGGGCAGGTGGAAGGGTTGTCTCTCGAAGACGAACCCACGGGT
GGTGAAAGAGGGGAATTGGAGAATGGCTCGCTTGCTGATGCCGCCAGCAAAGGCAACGGCGATCCTGATGACGAC
GATGTCGATGTTGCCGGCTGGGACCTGGGTCCCGATCTCATAGCCGGAGCCGAGGGCGATTCGATGAATGTGGCA
AGCACTGAATCCGGGAAAGCTGGAAGCAGCGAAGCAGATCTTTGGGCCCGAAACTCGCCTCTGGCTGTTGATCAT
GTTGCCGGCGGCTCCTTTGACACGGCCATGCAGCTTTTGAACCGCCAAGTCGGGGCTGTCAACTTTATGCCTCTC
AAGTCTCGTTTCCTGGAGGTATTCCAAGCATCGAAGACATTTTTACCTGCTTTACCTAGTATGCCCTCTTTGACC
AACTATGTGCGCCGCACCACGGAAGAGATGGACTCTCGCCACGTACTGCCCGCTATTCCCCGCGATCTGGAGCAT
CTGGCCGCGAACGAACTGCAAAAAGGCTATGACGCGATGAAGGCAAACAAGCTGGAGCACGGGATTGAAACCTTC
AGGGGTATTTTGCATTGCATTCTCGTCAATGCCGTATCTAGCGAGGATGAAGTGGCCGAAGCAAAAAAACTTGTC
ACTTCAGCATGCGAGTATGTGGTGGCAATGAGCATTGAGCTCGCACGAAGACGGCTTGGACGTCCTGAAGCTGTG
GTTGAAAACCCATCGATGCTCAAGAGGAGTCTCGAATTGTCGGCGTACTTTACCATTCCCAAGATCGAAGTGCCA
CACAGACAGCTGGCCCTATTGAGCGCTATGCAGCTAGCCATTAAAAGCAAAAACTTCAATTCAGCTCTGAGCTTT
GCCAATCGAATCATTGCAAATGGCGGCTCTAGCAAGATCATTGAGAGTGTGAGTCTGATTAGCCTTTTACGTCTA
TTGCTCGAGTAGGATGTCCCTTTACTAATGTTGATTGAAACACAACAGGCAAAGAGAACGAAGCTTCAGTGCGAG
CGAAATCCCAATGACGCTCTGGATATCGAATTTGACCAATTCGCTGAGTTCGACATTTGCGCCGCCAGTCACACA
CCAATTTACAGTGGCACACCATTTGAGGAATGCGCATTTGACGGGTCAAAGTATCACACCAAATTCAAGGGTACG
GCGTGTACAGTGTGCCAAGTATGCGAGGTTGGTAAGCTTGGAAGTGGGTTAAAACTCTTGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail