Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4816
Gene name
LocationContig_336:2152..5477
Strand+
Gene length (bp)3325
Transcript length (bp)3087
Coding sequence length (bp)3087
Protein length (aa) 1029

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18829 Importin_rep_6 Importin repeat 6 5.8E-38 769 879
PF18808 Importin_rep_4 Importin repeat 1.2E-32 275 367
PF02985 HEAT HEAT repeat 1.7E-03 411 438
PF13513 HEAT_EZ HEAT-like repeat 2.7E-10 383 437
PF12460 MMS19_C RNAPII transcription regulator C-terminal 7.8E-09 453 566

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 8 1028 0.0E+00
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 1 1028 0.0E+00
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 15 1027 0.0E+00
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 15 1027 0.0E+00
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 11 1027 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 8 1028 0.0E+00
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 1 1028 0.0E+00
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 15 1027 0.0E+00
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 15 1027 0.0E+00
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 11 1027 0.0E+00
sp|O60518|RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens GN=RANBP6 PE=1 SV=2 11 1027 5.0E-179
sp|Q54EW3|IPO5_DICDI Probable importin-5 homolog OS=Dictyostelium discoideum GN=DDB_G0291650 PE=3 SV=1 12 1015 2.0E-84
sp|P40069|IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP123 PE=1 SV=1 12 632 2.0E-22
sp|O60100|IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap123 PE=3 SV=1 4 936 5.0E-19
sp|Q8H0U4|TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana GN=TRN1 PE=1 SV=1 89 571 3.0E-15
sp|B8ARW2|TNPO1_ORYSI Transportin-1 OS=Oryza sativa subsp. indica GN=OsI_18044 PE=2 SV=1 88 571 3.0E-14
sp|B9FDR3|TNPO1_ORYSJ Transportin-1 OS=Oryza sativa subsp. japonica GN=TRN1 PE=3 SV=2 88 571 4.0E-14
sp|Q8VI75|IPO4_MOUSE Importin-4 OS=Mus musculus GN=Ipo4 PE=1 SV=1 10 626 3.0E-11
sp|Q9FJD4|IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana GN=KPNB1 PE=1 SV=1 11 578 2.0E-08
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 333 544 3.0E-06
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 364 540 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4829
Ophiocordyceps australis map64 (Brazil) OphauB2|4816 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01774
Ophiocordyceps camponoti-rufipedis Ophun1|4909
Ophiocordyceps kimflemingae Ophio5|4974
Ophiocordyceps subramaniannii Hirsu2|3064

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4816
MSLLSANVHAELSQLLQALQSADNVVRSQAEEHLQSNWTSPRPDLLLMGLAEQIQAAQQNTTRSFAAVIFRRISS
KTRKLESGDAVDTFSSLSQEQAVAIRQKLLETLASEPERAVRNKISDAVAEVARQYVDNNDSWPELLGALFQLSQ
TPEAEKRENAFRIFATTPSIIQSQHEEAVLQAFQKGFKDDSVMVRLAAMDAFAAFFKSIGKKSQLKYYALIPDVL
NILPPIKESQESDDLSKALVALIDLAETAPKMFKPLFHNLVQFGISVIQEKELDSICRQNALELMATFADYAPSM
CKKDSSYTADMITQCLSLMTDLGEDDEDAAEWLASDDLEQDESDQNHVAGEQTMDRLANKLGGQTILAPTFNWLP
RMMTSMAWRDRHAALMAISAISEGCRDLMIGELNQVLDLVIPALQDPHPRVRWAGCNALGQMSTDFAPKMQTEHY
DRVLTTIIPVLSSPEARVKSHAAAALVNFCEEAEKTVLEPYLDSLLSHLFQLLQSDQRFVQEQALSTIATVADAA
EAAFSKYYDTLMPLLVSVLQNQTEKEYRLLRAKAMECSTLIALAVGRERLGADALTLVKLLANIQTSITEADDPQ
SQYLMHSWGRMCRVLGTDFMPFLDDVMLPLLRLATAKADIQLLEDEDQAEQMNGEDGWEFVPLKGKVIGIRTSTM
DDKHMAIELLVVYASVLEGAFAPYVANIMDKVALPGLAFFFHDPVRYMSSKLVPHLLISYKKAYGCPSNELTGLW
NATVDKLLEVLTAEPSIETLAEMYQCFYESVQVIGKGCLNSEHMSRFIDSASSAIEDYKDRVSQRSDEKEAATAD
DAEDEAEELLVAIEDDQTLLSDMNKAFHAIFKHHGETFLPAWERLMPTYQAFLGSSDAMQRQWGLCIMDDVLEYC
GPDSSRYAEVVTQPLIDGCRDPSPAIRQAAAYGIGVAAHRGGVPWSQFVGVSVPFILQMTQVTNARDEENIYATE
NACAALAKVLHYSPASIGDVQGTISQWIDTLPVTNDEEAAPYAYAYLTELIDQ*
Coding >OphauB2|4816
ATGTCTTTGCTTTCCGCCAATGTTCATGCTGAGCTGTCGCAGCTCCTTCAAGCACTTCAGTCCGCCGACAATGTT
GTCCGGTCACAGGCAGAGGAGCACCTACAATCCAACTGGACTAGCCCTCGGCCGGATCTTCTCTTGATGGGACTC
GCAGAGCAAATTCAGGCTGCACAACAAAATACTACACGCTCCTTTGCTGCAGTCATATTCCGTAGAATTTCGTCC
AAGACGAGAAAACTCGAATCAGGAGACGCTGTCGACACCTTTTCCTCCTTGTCTCAAGAGCAAGCCGTGGCTATT
CGCCAAAAGTTGCTAGAAACGCTTGCATCCGAGCCCGAGCGCGCTGTTCGCAACAAAATTAGCGACGCCGTGGCA
GAGGTTGCACGGCAGTATGTTGACAATAATGATTCTTGGCCAGAGCTTCTTGGTGCACTCTTCCAGCTCAGCCAG
ACACCAGAGGCCGAGAAGCGGGAAAATGCGTTTAGGATTTTTGCCACCACTCCAAGTATTATCCAAAGCCAGCAC
GAAGAGGCTGTTCTACAAGCCTTCCAAAAAGGGTTCAAGGACGATTCCGTCATGGTTCGTCTTGCCGCCATGGAC
GCCTTTGCCGCCTTCTTCAAGTCGATTGGAAAGAAATCTCAGTTGAAATACTATGCCCTCATTCCCGACGTTCTT
AATATCCTGCCACCTATTAAGGAATCACAAGAGTCAGATGACTTGAGCAAGGCTCTCGTGGCCCTCATTGACCTC
GCCGAGACGGCACCCAAGATGTTCAAGCCGCTATTTCATAACCTTGTTCAATTCGGCATATCCGTCATTCAGGAG
AAAGAGCTCGACAGCATTTGCAGGCAAAACGCTCTTGAGCTCATGGCTACCTTTGCCGACTATGCACCCTCAATG
TGCAAGAAGGACTCCTCCTACACTGCAGACATGATTACCCAATGTCTCAGCCTCATGACTGACTTGGGAGAGGAC
GATGAAGATGCTGCCGAATGGCTTGCATCCGATGATCTTGAACAGGACGAGAGTGACCAGAACCACGTAGCCGGG
GAGCAAACCATGGATCGTCTAGCCAACAAGCTTGGGGGTCAAACCATTCTAGCTCCAACTTTCAACTGGTTACCT
AGAATGATGACCTCGATGGCGTGGAGAGACCGGCATGCTGCGCTAATGGCTATTTCCGCCATCTCAGAAGGTTGT
CGCGATCTTATGATTGGAGAGCTCAATCAAGTACTTGATTTGGTGATTCCGGCTCTGCAGGATCCACATCCTCGC
GTGCGATGGGCCGGTTGCAACGCCTTGGGGCAGATGAGTACCGACTTTGCTCCCAAAATGCAGACTGAACATTAT
GATCGAGTTCTTACGACCATCATTCCTGTACTCAGCTCCCCAGAAGCTAGAGTCAAGTCCCACGCTGCGGCAGCA
TTGGTCAACTTTTGCGAGGAGGCTGAAAAGACGGTTTTGGAGCCTTATTTAGACAGTCTTCTGTCTCATCTCTTT
CAGCTACTTCAGAGCGACCAGAGATTTGTGCAAGAGCAGGCTTTGTCCACCATTGCAACAGTGGCAGATGCGGCC
GAGGCCGCCTTTTCCAAGTACTACGATACTCTTATGCCACTTCTCGTAAGTGTGCTGCAAAACCAAACAGAAAAG
GAGTATAGACTATTGCGCGCCAAGGCTATGGAATGCTCGACTCTCATCGCCTTGGCTGTTGGACGTGAGCGTCTT
GGAGCTGATGCCTTGACATTGGTCAAACTTCTTGCAAACATTCAGACATCTATTACAGAAGCAGATGATCCCCAG
TCACAGTATCTTATGCATAGCTGGGGTAGGATGTGCCGTGTTCTTGGCACTGATTTCATGCCTTTCTTGGATGAT
GTCATGCTGCCTCTCCTCCGGCTAGCCACGGCCAAGGCTGACATTCAGTTACTGGAAGACGAGGACCAGGCTGAA
CAAATGAACGGTGAAGACGGCTGGGAGTTTGTCCCACTAAAGGGCAAGGTTATTGGCATTCGCACAAGCACAATG
GACGACAAACATATGGCTATAGAACTACTTGTTGTATACGCCTCTGTCCTCGAAGGCGCCTTTGCCCCGTACGTG
GCCAACATCATGGACAAGGTTGCACTGCCAGGTCTCGCCTTCTTTTTCCACGATCCTGTTCGCTACATGTCGTCA
AAACTTGTGCCGCATCTGCTGATTTCGTACAAAAAGGCATATGGTTGCCCCTCTAACGAGCTTACTGGTCTCTGG
AATGCAACCGTCGACAAACTTTTGGAAGTACTAACGGCTGAACCATCAATCGAGACATTGGCCGAGATGTATCAA
TGCTTTTATGAGTCTGTTCAAGTTATTGGCAAAGGCTGTTTGAACTCTGAACACATGTCGCGTTTTATTGACTCG
GCCAGTTCAGCAATCGAGGACTATAAAGATAGGGTTTCCCAACGCAGCGATGAAAAAGAGGCCGCCACAGCTGAT
GATGCCGAGGACGAGGCTGAAGAACTGCTAGTGGCCATTGAGGATGACCAAACCCTGCTCTCAGACATGAACAAG
GCGTTTCATGCCATATTCAAGCATCATGGAGAGACTTTTCTGCCCGCATGGGAACGGCTAATGCCCACATATCAG
GCCTTCCTAGGTTCCTCCGATGCCATGCAGAGGCAATGGGGTCTATGCATAATGGACGACGTGTTGGAATACTGC
GGTCCAGATAGCAGTCGGTATGCAGAAGTTGTTACTCAACCTCTTATAGACGGCTGCAGAGACCCGTCGCCGGCC
ATTCGACAAGCAGCCGCCTATGGAATAGGAGTAGCTGCTCATCGGGGCGGAGTGCCGTGGTCTCAGTTTGTCGGA
GTTTCCGTACCATTCATCCTACAGATGACTCAGGTGACCAACGCGAGGGATGAAGAGAATATCTATGCCACGGAA
AATGCCTGTGCTGCGCTGGCTAAAGTTCTGCACTATAGCCCTGCCAGCATTGGGGATGTACAAGGGACAATTTCC
CAGTGGATTGATACGCTACCAGTGACCAACGACGAAGAAGCGGCGCCATACGCATACGCCTACTTGACAGAGCTC
ATTGATCAGTAA
Transcript >OphauB2|4816
ATGTCTTTGCTTTCCGCCAATGTTCATGCTGAGCTGTCGCAGCTCCTTCAAGCACTTCAGTCCGCCGACAATGTT
GTCCGGTCACAGGCAGAGGAGCACCTACAATCCAACTGGACTAGCCCTCGGCCGGATCTTCTCTTGATGGGACTC
GCAGAGCAAATTCAGGCTGCACAACAAAATACTACACGCTCCTTTGCTGCAGTCATATTCCGTAGAATTTCGTCC
AAGACGAGAAAACTCGAATCAGGAGACGCTGTCGACACCTTTTCCTCCTTGTCTCAAGAGCAAGCCGTGGCTATT
CGCCAAAAGTTGCTAGAAACGCTTGCATCCGAGCCCGAGCGCGCTGTTCGCAACAAAATTAGCGACGCCGTGGCA
GAGGTTGCACGGCAGTATGTTGACAATAATGATTCTTGGCCAGAGCTTCTTGGTGCACTCTTCCAGCTCAGCCAG
ACACCAGAGGCCGAGAAGCGGGAAAATGCGTTTAGGATTTTTGCCACCACTCCAAGTATTATCCAAAGCCAGCAC
GAAGAGGCTGTTCTACAAGCCTTCCAAAAAGGGTTCAAGGACGATTCCGTCATGGTTCGTCTTGCCGCCATGGAC
GCCTTTGCCGCCTTCTTCAAGTCGATTGGAAAGAAATCTCAGTTGAAATACTATGCCCTCATTCCCGACGTTCTT
AATATCCTGCCACCTATTAAGGAATCACAAGAGTCAGATGACTTGAGCAAGGCTCTCGTGGCCCTCATTGACCTC
GCCGAGACGGCACCCAAGATGTTCAAGCCGCTATTTCATAACCTTGTTCAATTCGGCATATCCGTCATTCAGGAG
AAAGAGCTCGACAGCATTTGCAGGCAAAACGCTCTTGAGCTCATGGCTACCTTTGCCGACTATGCACCCTCAATG
TGCAAGAAGGACTCCTCCTACACTGCAGACATGATTACCCAATGTCTCAGCCTCATGACTGACTTGGGAGAGGAC
GATGAAGATGCTGCCGAATGGCTTGCATCCGATGATCTTGAACAGGACGAGAGTGACCAGAACCACGTAGCCGGG
GAGCAAACCATGGATCGTCTAGCCAACAAGCTTGGGGGTCAAACCATTCTAGCTCCAACTTTCAACTGGTTACCT
AGAATGATGACCTCGATGGCGTGGAGAGACCGGCATGCTGCGCTAATGGCTATTTCCGCCATCTCAGAAGGTTGT
CGCGATCTTATGATTGGAGAGCTCAATCAAGTACTTGATTTGGTGATTCCGGCTCTGCAGGATCCACATCCTCGC
GTGCGATGGGCCGGTTGCAACGCCTTGGGGCAGATGAGTACCGACTTTGCTCCCAAAATGCAGACTGAACATTAT
GATCGAGTTCTTACGACCATCATTCCTGTACTCAGCTCCCCAGAAGCTAGAGTCAAGTCCCACGCTGCGGCAGCA
TTGGTCAACTTTTGCGAGGAGGCTGAAAAGACGGTTTTGGAGCCTTATTTAGACAGTCTTCTGTCTCATCTCTTT
CAGCTACTTCAGAGCGACCAGAGATTTGTGCAAGAGCAGGCTTTGTCCACCATTGCAACAGTGGCAGATGCGGCC
GAGGCCGCCTTTTCCAAGTACTACGATACTCTTATGCCACTTCTCGTAAGTGTGCTGCAAAACCAAACAGAAAAG
GAGTATAGACTATTGCGCGCCAAGGCTATGGAATGCTCGACTCTCATCGCCTTGGCTGTTGGACGTGAGCGTCTT
GGAGCTGATGCCTTGACATTGGTCAAACTTCTTGCAAACATTCAGACATCTATTACAGAAGCAGATGATCCCCAG
TCACAGTATCTTATGCATAGCTGGGGTAGGATGTGCCGTGTTCTTGGCACTGATTTCATGCCTTTCTTGGATGAT
GTCATGCTGCCTCTCCTCCGGCTAGCCACGGCCAAGGCTGACATTCAGTTACTGGAAGACGAGGACCAGGCTGAA
CAAATGAACGGTGAAGACGGCTGGGAGTTTGTCCCACTAAAGGGCAAGGTTATTGGCATTCGCACAAGCACAATG
GACGACAAACATATGGCTATAGAACTACTTGTTGTATACGCCTCTGTCCTCGAAGGCGCCTTTGCCCCGTACGTG
GCCAACATCATGGACAAGGTTGCACTGCCAGGTCTCGCCTTCTTTTTCCACGATCCTGTTCGCTACATGTCGTCA
AAACTTGTGCCGCATCTGCTGATTTCGTACAAAAAGGCATATGGTTGCCCCTCTAACGAGCTTACTGGTCTCTGG
AATGCAACCGTCGACAAACTTTTGGAAGTACTAACGGCTGAACCATCAATCGAGACATTGGCCGAGATGTATCAA
TGCTTTTATGAGTCTGTTCAAGTTATTGGCAAAGGCTGTTTGAACTCTGAACACATGTCGCGTTTTATTGACTCG
GCCAGTTCAGCAATCGAGGACTATAAAGATAGGGTTTCCCAACGCAGCGATGAAAAAGAGGCCGCCACAGCTGAT
GATGCCGAGGACGAGGCTGAAGAACTGCTAGTGGCCATTGAGGATGACCAAACCCTGCTCTCAGACATGAACAAG
GCGTTTCATGCCATATTCAAGCATCATGGAGAGACTTTTCTGCCCGCATGGGAACGGCTAATGCCCACATATCAG
GCCTTCCTAGGTTCCTCCGATGCCATGCAGAGGCAATGGGGTCTATGCATAATGGACGACGTGTTGGAATACTGC
GGTCCAGATAGCAGTCGGTATGCAGAAGTTGTTACTCAACCTCTTATAGACGGCTGCAGAGACCCGTCGCCGGCC
ATTCGACAAGCAGCCGCCTATGGAATAGGAGTAGCTGCTCATCGGGGCGGAGTGCCGTGGTCTCAGTTTGTCGGA
GTTTCCGTACCATTCATCCTACAGATGACTCAGGTGACCAACGCGAGGGATGAAGAGAATATCTATGCCACGGAA
AATGCCTGTGCTGCGCTGGCTAAAGTTCTGCACTATAGCCCTGCCAGCATTGGGGATGTACAAGGGACAATTTCC
CAGTGGATTGATACGCTACCAGTGACCAACGACGAAGAAGCGGCGCCATACGCATACGCCTACTTGACAGAGCTC
ATTGATCAGTAA
Gene >OphauB2|4816
ATGTCTTTGCTTTCCGCCAATGTTCATGCTGAGCTGTCGCAGCTCCTTCAAGCACTTCAGTCCGCCGACAATGTT
GTCCGGTCACAGGCAGAGGAGCACCTACAATCCAACTGGACTAGCCCTCGGCCGGATCTTCTCTTGATGGGACTC
GCAGAGCAAATTCAGGCTGCACAACAAAATACTGTTTGTCCCCCGGTACCTTCGCTATAGTGCCAAGGCCTCCAC
TCACATCAACAGACACGCTCCTTTGCTGCAGTCATATTCCGTAGAATTTCGTCCAAGACGAGAAAACTCGAATCA
GGAGACGCTGTCGACACCTTTTCCTCCTTGTCTCAAGAGCAAGCCGTGGCTATTCGCCAAAAGTTGCTAGAAACG
CTTGCATCCGAGCCCGAGCGCGCTGTTCGCAACAAAATTAGCGACGCCGTGGCAGAGGTTGCACGGCAGTATGTT
GACAATAGTCAGTAAGCAGCGATCAAGACTTCCCGGTTACCTACTAATCATCAGCCTGCTTTTCAAGATGATTCT
TGGCCAGAGCTTCTTGGTGCACTCTTCCAGCTCAGCCAGACACCAGAGGCCGAGAAGCGGGAAAATGCGTTTAGG
ATTTTTGCCACCACTCCAAGTATTATCCAAAGCCAGCACGAAGAGGCTGTTCTACAAGCCTTCCAAAAAGGGTTC
AAGGACGATTCCGTCATGGTACCATCCTGATCCCAGAGGCCCCTGTACTCCACTAACATGGCCCAGGTTCGTCTT
GCCGCCATGGACGCCTTTGCCGCCTTCTTCAAGTCGATTGGAAAGAAATCTCAGTTGAAATACTATGCCCTCATT
CCCGACGTTCTTAATATCCTGCCACCTATTAAGGAATCACAAGAGTCAGATGACTTGAGCAAGGCTCTCGTGGCC
CTCATTGACCTCGCCGAGACGGCACCCAAGATGTTCAAGCCGCTATTTCATAACCTTGTTCAATTCGGCATATCC
GTCATTCAGGAGAAAGAGCTCGACAGCATTTGCAGGCAAAACGCTCTTGAGCTCATGGCTACCTTTGCCGACTAT
GCACCCTCAATGTGCAAGAAGGACTCCTCCTACACTGCAGACATGATTACCCAATGTCTCAGCCTCATGACTGAC
TTGGGAGAGGACGATGAAGATGCTGCCGAATGGCTTGCATCCGATGATGTGAGTAAAGCATCCCATCACTTGCTC
CCAGCCCTTTTCGTGTGGCAAGCCTCTACCAACTAACGAGGCGTGGCAGCTTGAACAGGACGAGAGTGACCAGAA
CCACGTAGCCGGGGAGCAAACCATGGATCGTCTAGCCAACAAGCTTGGGGGTCAAACCATTCTAGCTCCAACTTT
CAACTGGTTACCTAGAATGATGACCTCGATGGCGTGGAGAGACCGGCATGCTGCGCTAATGGCTATTTCCGCCAT
CTCAGAAGGTTGTCGCGATCTTATGATTGGAGAGCTCAATCAAGTACTTGATTTGGTGATTCCGGCTCTGCAGGA
TCCACATCCTCGCGTGCGATGGGCCGGTTGCAACGCCTTGGGGCAGATGAGTACCGACTTTGCTCCCAAAATGCA
GACTGAACATTATGATCGAGTTCTTACGACCATCATTCCTGTACTCAGCTCCCCAGAAGCTAGAGTCAAGTCCCA
CGCTGCGGCAGCATTGGTCAACTTTTGCGAGGAGGCTGAAAAGACGGTTTTGGAGCCTTATTTAGACAGTCTTCT
GTCTCATCTCTTTCAGCTACTTCAGAGCGACCAGAGATTTGTGCAAGAGCAGGCTTTGTCCACCATTGCAACAGT
GGCAGATGCGGCCGAGGCCGCCTTTTCCAAGTACTACGATACTCTTATGCCACTTCTCGTAAGTGTGCTGCAAAA
CCAAACAGAAAAGGAGTATAGACTATTGCGCGCCAAGGCTATGGAATGCTCGACTCTCATCGCCTTGGCTGTTGG
ACGTGAGCGTCTTGGAGCTGATGCCTTGACATTGGTCAAACTTCTTGCAAACATTCAGACATCTATTACAGAAGC
AGATGATCCCCAGTCACAGTATCTTATGCATAGCTGGGGTAGGATGTGCCGTGTTCTTGGCACTGATTTCATGCC
TTTCTTGGATGATGTCATGCTGCCTCTCCTCCGGCTAGCCACGGCCAAGGCTGACATTCAGTTACTGGAAGACGA
GGACCAGGCTGAACAAATGAACGGTGAAGACGGCTGGGAGTTTGTCCCACTAAAGGGCAAGGTTATTGGCATTCG
CACAAGCACAATGGACGACAAACATATGGCTATAGAACTACTTGTTGTATACGCCTCTGTCCTCGAAGGCGCCTT
TGCCCCGTACGTGGCCAACATCATGGACAAGGTTGCACTGCCAGGTCTCGCCTTCTTTTTCCACGATCCTGTTCG
CTACATGTCGTCAAAACTTGTGCCGCATCTGCTGATTTCGTACAAAAAGGCATATGGTTGCCCCTCTAACGAGCT
TACTGGTCTCTGGAATGCAACCGTCGACAAACTTTTGGAAGTACTAACGGCTGAACCATCAATCGAGACATTGGC
CGAGATGTATCAATGCTTTTATGAGTCTGTTCAAGTTATTGGCAAAGGCTGTTTGAACTCTGAACACATGTCGCG
TTTTATTGACTCGGCCAGTTCAGCAATCGAGGACTATAAAGATAGGGTTTCCCAACGCAGCGATGAAAAAGAGGC
CGCCACAGCTGATGATGCCGAGGACGAGGCTGAAGAACTGCTAGTGGCCATTGAGGATGACCAAACCCTGCTCTC
AGACATGAACAAGGCGTTTCATGCCATATTCAAGCATCATGGAGAGACTTTTCTGCCCGCATGGGAACGGCTAAT
GCCCACATATCAGGCCTTCCTAGGTTCCTCCGATGCCATGCAGAGGCAATGGGGTCTATGCATAATGGACGACGT
GTTGGAATACTGCGGTCCAGATAGCAGTCGGTATGCAGAAGTTGTTACTCAACCTCTTATAGACGGCTGCAGAGA
CCCGTCGCCGGCCATTCGACAAGCAGCCGCCTATGGAATAGGAGTAGCTGCTCATCGGGGCGGAGTGCCGTGGTC
TCAGTTTGTCGGAGTTTCCGTACCATTCATCCTACAGATGACTCAGGTGACCAACGCGAGGGATGAAGAGAATAT
CTATGCCACGGAAAATGCCTGTGCTGCGCTGGCTAAAGTTCTGCACTATAGCCCTGCCAGCATTGGGGATGTACA
AGGGACAATTTCCCAGTGGATTGATACGCTACCAGTGACCAACGACGAAGAAGCGGCGCCATACGCATACGCCTA
CTTGACAGAGCTCATTGATCAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail