Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4815
Gene name
LocationContig_336:40..1588
Strand-
Gene length (bp)1548
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 1.1E-03 193 232
PF00571 CBS CBS domain 1.5E-05 260 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q874W3|SDS23_PODAS Protein SDS23 OS=Podospora anserina GN=SDS23 PE=3 SV=1 29 475 9.0E-180
sp|Q2HHB4|SDS23_CHAGB Protein SDS23 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SDS23 PE=3 SV=1 31 475 5.0E-172
sp|A4QRM8|SDS23_MAGO7 Protein SDS23 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SDS23 PE=3 SV=1 30 448 1.0E-163
sp|A7F3V4|SDS23_SCLS1 Protein sds23 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sds23 PE=3 SV=1 20 470 3.0E-151
sp|A7FA72|SDS23_BOTFB Protein sds23 OS=Botryotinia fuckeliana (strain B05.10) GN=sds23 PE=3 SV=1 11 470 4.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q874W3|SDS23_PODAS Protein SDS23 OS=Podospora anserina GN=SDS23 PE=3 SV=1 29 475 9.0E-180
sp|Q2HHB4|SDS23_CHAGB Protein SDS23 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SDS23 PE=3 SV=1 31 475 5.0E-172
sp|A4QRM8|SDS23_MAGO7 Protein SDS23 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SDS23 PE=3 SV=1 30 448 1.0E-163
sp|A7F3V4|SDS23_SCLS1 Protein sds23 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sds23 PE=3 SV=1 20 470 3.0E-151
sp|A7FA72|SDS23_BOTFB Protein sds23 OS=Botryotinia fuckeliana (strain B05.10) GN=sds23 PE=3 SV=1 11 470 4.0E-151
sp|Q0U194|SDS23_PHANO Protein SDS23 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SDS23 PE=3 SV=1 30 447 3.0E-140
sp|A1CQZ4|SDS23_ASPCL Protein sds23 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sds23 PE=3 SV=1 31 447 3.0E-134
sp|A1D3V8|SDS23_NEOFI Protein sds23 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sds23 PE=3 SV=1 31 447 2.0E-129
sp|A2RB71|SDS23_ASPNC Protein sds23 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sds23 PE=3 SV=1 31 447 1.0E-121
sp|A7TL18|SDS23_VANPO Protein SDS23 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SDS23 PE=3 SV=1 71 456 4.0E-69
sp|Q75EC0|SDS23_ASHGO Protein SDS23 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SDS23 PE=3 SV=1 74 456 2.0E-68
sp|P38314|SDS24_YEAST Protein SDS24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS24 PE=1 SV=1 71 456 3.0E-68
sp|A6ZLF4|SDS24_YEAS7 Protein SDS24 OS=Saccharomyces cerevisiae (strain YJM789) GN=SDS24 PE=3 SV=1 71 456 3.0E-68
sp|Q6FMN0|SDS23_CANGA Protein SDS23 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDS23 PE=3 SV=1 81 458 8.0E-68
sp|Q6C5K4|SDS23_YARLI Protein SDS23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SDS23 PE=3 SV=1 79 445 3.0E-67
sp|Q6CUE1|SDS23_KLULA Protein SDS23 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SDS23 PE=3 SV=1 74 456 3.0E-66
sp|P53172|SDS23_YEAST Protein SDS23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS23 PE=1 SV=2 79 454 1.0E-62
sp|A6ZUC0|SDS23_YEAS7 Protein SDS23 OS=Saccharomyces cerevisiae (strain YJM789) GN=SDS23 PE=3 SV=1 79 454 2.0E-62
sp|A5DNL9|SDS23_PICGU Protein SDS23 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SDS23 PE=3 SV=2 77 446 3.0E-58
sp|Q6BMN7|SDS23_DEBHA Protein SDS23 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SDS23 PE=3 SV=2 43 453 2.0E-55
sp|A3LQC5|SDS23_PICST Protein SDS23 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SDS23 PE=3 SV=2 65 453 2.0E-55
sp|Q09826|SDS23_SCHPO Protein sds23/moc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds23 PE=1 SV=1 80 475 1.0E-54
sp|Q5A744|SDS23_CANAL Protein SDS23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SDS23 PE=2 SV=1 66 453 6.0E-54
sp|Q9MYP4|AAKG3_PIG 5'-AMP-activated protein kinase subunit gamma-3 OS=Sus scrofa GN=PRKAG3 PE=1 SV=2 176 369 4.0E-08
sp|Q9UGI9|AAKG3_HUMAN 5'-AMP-activated protein kinase subunit gamma-3 OS=Homo sapiens GN=PRKAG3 PE=1 SV=3 176 368 7.0E-08
sp|Q8BGM7|AAKG3_MOUSE 5'-AMP-activated protein kinase subunit gamma-3 OS=Mus musculus GN=Prkag3 PE=1 SV=1 176 369 2.0E-07
sp|Q2LL38|AAKG3_BOVIN 5'-AMP-activated protein kinase subunit gamma-3 OS=Bos taurus GN=PRKAG3 PE=2 SV=2 176 369 2.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5349
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4830
Ophiocordyceps australis map64 (Brazil) OphauB2|4815 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01773
Ophiocordyceps camponoti-rufipedis Ophun1|4910
Ophiocordyceps kimflemingae Ophio5|4973
Ophiocordyceps subramaniannii Hirsu2|5178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4815
MDAPSSITSKDVRPVKDKDAPSMSSTGRTTHRQTFADNLRNVPPSPRHRHPSLTQAAVQELLNHPPSGNRQVNSR
FAGREWRDVSVGELVSPRDVKWIDMDSSVEEATMMLLKSITNVVLVRENFASIKATSTFDYSDLNAYLLVVVGLS
RPEAQQIDLYNSIMAKGGQGLPISVREIQSLCKQEPLINMASTGNLSHAIEVLGSGIHRLLVTDSVGHVVGVLSQ
LRLIDFFWNESVNFAMVDRLYPVALRDLGIGSQRTISVNSDAPLSDALVLMNNEGLTSIAVVDNGQNVVGNISSK
DVRHLTTASSARLLDESCMHFISVILNERGMEEGRDAFPVFYVSPYSTLAHTVAKLVATRSHRMWIVESASPSPS
APATPLIGPQSFANSAVATNQAPTSPVPTAVVPASAMAGARLSGKLCGVVSLTDILNTFARFTGLHPTDPGEQRA
RRRRSSSTSSMRPSLDSSRASLDIRW*
Coding >OphauB2|4815
ATGGATGCCCCGTCGAGCATCACCAGCAAGGATGTACGACCAGTCAAAGACAAGGATGCGCCATCAATGAGCAGC
ACGGGCAGGACGACACACCGACAAACCTTTGCCGACAACCTACGCAATGTTCCTCCTTCTCCACGTCATCGTCAT
CCGTCTCTGACCCAGGCCGCTGTTCAGGAACTCCTCAACCACCCACCGTCGGGCAACAGACAAGTCAACTCGCGA
TTTGCCGGCCGCGAGTGGCGGGATGTCAGTGTCGGCGAGCTAGTGTCTCCCCGCGATGTCAAGTGGATTGACATG
GACAGCAGTGTTGAAGAGGCTACCATGATGCTGCTTAAGAGCATTACAAACGTGGTACTTGTGCGCGAGAATTTT
GCGTCGATAAAGGCCACGTCGACTTTTGACTATAGTGACCTCAACGCCTACTTGCTTGTTGTTGTCGGCTTGTCG
AGGCCTGAAGCCCAACAGATCGACTTGTACAATAGCATAATGGCCAAGGGCGGCCAGGGGCTTCCTATTTCAGTT
CGTGAGATACAGTCACTGTGTAAACAGGAGCCACTGATTAACATGGCATCGACTGGGAACCTCTCTCATGCCATC
GAGGTCTTGGGCAGCGGCATTCATCGGCTATTAGTTACTGACTCAGTCGGACATGTGGTCGGCGTCCTCAGCCAG
TTGAGACTGATTGATTTCTTCTGGAACGAGAGTGTTAATTTTGCTATGGTGGATCGGCTATATCCAGTAGCCCTA
CGGGACTTGGGCATTGGCTCTCAGCGCACCATTTCTGTCAATTCCGATGCACCCCTTTCAGACGCGCTAGTCCTC
ATGAACAATGAGGGCTTGACAAGTATTGCCGTCGTGGACAATGGGCAGAATGTAGTCGGAAATATTTCGTCCAAG
GACGTACGACACTTGACAACTGCATCCAGTGCAAGGCTGCTTGACGAGTCTTGCATGCACTTTATCTCTGTTATA
CTCAATGAGAGAGGCATGGAGGAGGGCCGAGATGCGTTTCCCGTTTTCTACGTCAGTCCTTACTCAACACTGGCT
CATACAGTAGCCAAACTGGTAGCGACGAGGTCGCATCGCATGTGGATTGTCGAATCAGCATCGCCCTCACCCTCG
GCCCCCGCAACGCCGCTTATCGGGCCCCAGAGCTTCGCAAATAGTGCTGTGGCCACGAATCAAGCTCCCACGTCG
CCTGTTCCCACAGCAGTTGTGCCAGCCTCGGCCATGGCAGGCGCACGACTATCGGGCAAGCTATGCGGCGTAGTA
TCACTGACGGATATTCTCAATACCTTTGCCCGCTTCACCGGACTGCATCCCACAGATCCAGGAGAACAGCGGGCC
CGAAGACGGCGAAGCTCGAGTACTAGTTCGATGCGCCCGAGCCTCGACTCGTCACGCGCTAGTCTGGATATCCGG
TGGTAA
Transcript >OphauB2|4815
ATGGATGCCCCGTCGAGCATCACCAGCAAGGATGTACGACCAGTCAAAGACAAGGATGCGCCATCAATGAGCAGC
ACGGGCAGGACGACACACCGACAAACCTTTGCCGACAACCTACGCAATGTTCCTCCTTCTCCACGTCATCGTCAT
CCGTCTCTGACCCAGGCCGCTGTTCAGGAACTCCTCAACCACCCACCGTCGGGCAACAGACAAGTCAACTCGCGA
TTTGCCGGCCGCGAGTGGCGGGATGTCAGTGTCGGCGAGCTAGTGTCTCCCCGCGATGTCAAGTGGATTGACATG
GACAGCAGTGTTGAAGAGGCTACCATGATGCTGCTTAAGAGCATTACAAACGTGGTACTTGTGCGCGAGAATTTT
GCGTCGATAAAGGCCACGTCGACTTTTGACTATAGTGACCTCAACGCCTACTTGCTTGTTGTTGTCGGCTTGTCG
AGGCCTGAAGCCCAACAGATCGACTTGTACAATAGCATAATGGCCAAGGGCGGCCAGGGGCTTCCTATTTCAGTT
CGTGAGATACAGTCACTGTGTAAACAGGAGCCACTGATTAACATGGCATCGACTGGGAACCTCTCTCATGCCATC
GAGGTCTTGGGCAGCGGCATTCATCGGCTATTAGTTACTGACTCAGTCGGACATGTGGTCGGCGTCCTCAGCCAG
TTGAGACTGATTGATTTCTTCTGGAACGAGAGTGTTAATTTTGCTATGGTGGATCGGCTATATCCAGTAGCCCTA
CGGGACTTGGGCATTGGCTCTCAGCGCACCATTTCTGTCAATTCCGATGCACCCCTTTCAGACGCGCTAGTCCTC
ATGAACAATGAGGGCTTGACAAGTATTGCCGTCGTGGACAATGGGCAGAATGTAGTCGGAAATATTTCGTCCAAG
GACGTACGACACTTGACAACTGCATCCAGTGCAAGGCTGCTTGACGAGTCTTGCATGCACTTTATCTCTGTTATA
CTCAATGAGAGAGGCATGGAGGAGGGCCGAGATGCGTTTCCCGTTTTCTACGTCAGTCCTTACTCAACACTGGCT
CATACAGTAGCCAAACTGGTAGCGACGAGGTCGCATCGCATGTGGATTGTCGAATCAGCATCGCCCTCACCCTCG
GCCCCCGCAACGCCGCTTATCGGGCCCCAGAGCTTCGCAAATAGTGCTGTGGCCACGAATCAAGCTCCCACGTCG
CCTGTTCCCACAGCAGTTGTGCCAGCCTCGGCCATGGCAGGCGCACGACTATCGGGCAAGCTATGCGGCGTAGTA
TCACTGACGGATATTCTCAATACCTTTGCCCGCTTCACCGGACTGCATCCCACAGATCCAGGAGAACAGCGGGCC
CGAAGACGGCGAAGCTCGAGTACTAGTTCGATGCGCCCGAGCCTCGACTCGTCACGCGCTAGTCTGGATATCCGG
TGGTAA
Gene >OphauB2|4815
ATGGATGCCCCGTCGAGCATCACCAGCAAGGATGTACGACCAGTCAAAGACAAGGATGCGCCATCAATGAGCAGC
ACGGGCAGGACGACACACCGACAAACCTTTGCCGACAACCTACGCAATGTTCCTCCTTCTCCACGTCATCGTCAT
CCGTCTCTGACCCAGGCCGCTGTTCAGGAACTCCTCAACCACCCACCGTCGGGCAACAGACAAGTCAACTCGCGA
TTTGCCGGCCGCGAGTGGCGGGATGTCAGTGTCGGCGAGCTAGTGTCTCCCCGCGATGTCAAGTGGATTGACATG
GACAGCAGTGTTGAAGAGGCTACCATGGTGAGAGGGAGGAGCCCTGTCGGCACCCAGGTGGCTAATTTGGAAGCA
GATGCTGCTTAAGAGCATTACAAACGTGGTACTTGTGCGCGAGAATTTTGCGTCGATAAAGGCCACGTCGACTTT
TGACTATAGTGACCTCAACGCCTACTTGCTTGTTGTTGTCGGCTTGTCGAGGCCTGAAGCCCAACAGATCGACTT
GTACAATAGCATAATGGCCAAGGGCGGCCAGGGGCTTCCTATTTCAGTTCGTGAGATACAGTCACTGTGTAAACA
GGAGCCACTGATTAACATGGCATCGACTGGGAACCTCTCTCATGCCATCGAGGTCTTGGGCAGCGGCATTCATCG
GCTATTAGTTACTGACTCAGTCGGACATGTGGTCGGCGTCCTCAGCCAGTTGAGACTGATTGATTTCTTCTGGAA
CGAGAGTGTTAATTTTGCTATGGTGGATCGGCTATATCCAGTAGCCCTACGGGACTTGGGCATTGGCTCTCAGCG
CACCATTTCTGTCAAGTAAGTATGTGCTGCCAACTGGCCTGTGACGACTGCAAAAGGGCTGATGAGCTGAATTTA
ACCCGTAGTTCCGATGCACCCCTTTCAGACGCGCTAGTCCTCATGAACAATGAGGGCTTGACAAGTATTGCCGTC
GTGGACAATGGGCAGAATGTAGTCGGAAATATTTCGTCCAAGGACGTACGACACTTGACAACTGCATCCAGTGCA
AGGCTGCTTGACGAGTCTTGCATGCACTTTATCTCTGTTATACTCAATGAGAGAGGCATGGAGGAGGGCCGAGAT
GCGTTTCCCGTTTTCTACGTCAGTCCTTACTCAACACTGGCTCATACAGTAGCCAAACTGGTAGCGACGAGGTCG
CATCGCATGTGGATTGTCGAATCAGCATCGCCCTCACCCTCGGCCCCCGCAACGCCGCTTATCGGGCCCCAGAGC
TTCGCAAATAGTGCTGTGGCCACGAATCAAGCTCCCACGTCGCCTGTTCCCACAGCAGTTGTGCCAGCCTCGGCC
ATGGCAGGCGCACGACTATCGGGCAAGCTATGCGGCGTAGTATCACTGACGGATATTCTCAATACCTTTGCCCGC
TTCACCGGACTGCATCCCACAGATCCAGGAGAACAGCGGGCCCGAAGACGGCGAAGCTCGAGTACTAGTTCGATG
CGCCCGAGCCTCGACTCGTCACGCGCTAGTCTGGATATCCGGTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail