Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4811
Gene name
LocationContig_333:4120..5947
Strand+
Gene length (bp)1827
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01743 PolyA_pol Poly A polymerase head domain 2.6E-24 92 236
PF12627 PolyA_pol_RNAbd Probable RNA and SrmB- binding site of polymerase A 2.9E-07 264 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21269|CCA1_YEAST CCA tRNA nucleotidyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCA1 PE=1 SV=1 87 552 2.0E-87
sp|Q9P4S5|CCA1_CANGA CCA tRNA nucleotidyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCA1 PE=1 SV=2 56 548 3.0E-78
sp|Q9Y7U9|CCA2_SCHPO Putative CCA tRNA nucleotidyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC645.10 PE=3 SV=1 61 549 1.0E-73
sp|Q9UTQ0|CCA1_SCHPO Putative CCA tRNA nucleotidyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.04c PE=3 SV=2 58 549 5.0E-72
sp|Q88W02|CCA_LACPL CCA-adding enzyme OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cca PE=3 SV=1 75 340 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21269|CCA1_YEAST CCA tRNA nucleotidyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCA1 PE=1 SV=1 87 552 2.0E-87
sp|Q9P4S5|CCA1_CANGA CCA tRNA nucleotidyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCA1 PE=1 SV=2 56 548 3.0E-78
sp|Q9Y7U9|CCA2_SCHPO Putative CCA tRNA nucleotidyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC645.10 PE=3 SV=1 61 549 1.0E-73
sp|Q9UTQ0|CCA1_SCHPO Putative CCA tRNA nucleotidyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.04c PE=3 SV=2 58 549 5.0E-72
sp|Q88W02|CCA_LACPL CCA-adding enzyme OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cca PE=3 SV=1 75 340 1.0E-21
sp|Q03F94|CCA_PEDPA CCA-adding enzyme OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=cca PE=3 SV=1 93 324 6.0E-20
sp|Q03S97|CCA_LACBA CCA-adding enzyme OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=cca PE=3 SV=1 93 309 1.0E-18
sp|B2G721|CCA_LACRJ CCA-adding enzyme OS=Lactobacillus reuteri (strain JCM 1112) GN=cca PE=3 SV=1 93 319 1.0E-18
sp|A5VJK7|CCA_LACRD CCA-adding enzyme OS=Lactobacillus reuteri (strain DSM 20016) GN=cca PE=3 SV=1 93 319 1.0E-18
sp|Q03Y57|CCA_LEUMM CCA-adding enzyme OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=cca PE=3 SV=1 93 311 5.0E-18
sp|A8FEH9|CCA_BACP2 CCA-adding enzyme OS=Bacillus pumilus (strain SAFR-032) GN=cca PE=3 SV=1 93 321 6.0E-18
sp|B3WE84|CCA_LACCB CCA-adding enzyme OS=Lactobacillus casei (strain BL23) GN=cca PE=3 SV=1 75 332 9.0E-18
sp|Q039G0|CCA_LACC3 CCA-adding enzyme OS=Lactobacillus casei (strain ATCC 334) GN=cca PE=3 SV=1 75 332 9.0E-18
sp|B2GC39|CCA_LACF3 CCA-adding enzyme OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=cca PE=3 SV=1 93 303 4.0E-17
sp|B9DNX1|CCA_STACT CCA-adding enzyme OS=Staphylococcus carnosus (strain TM300) GN=cca PE=3 SV=1 93 321 4.0E-17
sp|Q1WU19|CCA_LACS1 CCA-adding enzyme OS=Lactobacillus salivarius (strain UCC118) GN=cca PE=3 SV=1 93 326 6.0E-17
sp|Q38WX5|CCA_LACSS CCA-adding enzyme OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=cca PE=3 SV=1 73 449 1.0E-16
sp|A8YV39|CCA_LACH4 CCA-adding enzyme OS=Lactobacillus helveticus (strain DPC 4571) GN=cca PE=3 SV=1 93 312 1.0E-16
sp|P44439|PCNB_HAEIN Poly(A) polymerase I OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pcnB PE=3 SV=1 31 322 3.0E-16
sp|A4VUK6|CCA_STRSY CCA-adding enzyme OS=Streptococcus suis (strain 05ZYH33) GN=cca PE=3 SV=1 93 304 4.0E-16
sp|A4W0U8|CCA_STRS2 CCA-adding enzyme OS=Streptococcus suis (strain 98HAH33) GN=cca PE=3 SV=1 93 304 4.0E-16
sp|Q8DUL8|CCA_STRMU CCA-adding enzyme OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=cca PE=3 SV=1 70 304 5.0E-16
sp|Q74JK7|CCA_LACJO CCA-adding enzyme OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=cca PE=3 SV=1 73 299 1.0E-15
sp|P0ABF1|PCNB_ECOLI Poly(A) polymerase I OS=Escherichia coli (strain K12) GN=pcnB PE=1 SV=2 95 322 2.0E-15
sp|P0ABF2|PCNB_ECOL6 Poly(A) polymerase I OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pcnB PE=3 SV=2 95 322 2.0E-15
sp|P0ABF3|PCNB_ECO57 Poly(A) polymerase I OS=Escherichia coli O157:H7 GN=pcnB PE=3 SV=2 95 322 2.0E-15
sp|P42977|CCA_BACSU CCA-adding enzyme OS=Bacillus subtilis (strain 168) GN=cca PE=3 SV=2 93 321 2.0E-15
sp|Q03M28|CCA_STRTD CCA-adding enzyme OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=cca PE=3 SV=1 70 300 4.0E-15
sp|Q043S5|CCA_LACGA CCA-adding enzyme OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=cca PE=3 SV=1 73 299 4.0E-15
sp|Q5M5P1|CCA_STRT2 CCA-adding enzyme OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=cca PE=3 SV=1 70 300 6.0E-15
sp|Q5M153|CCA_STRT1 CCA-adding enzyme OS=Streptococcus thermophilus (strain CNRZ 1066) GN=cca PE=3 SV=1 70 300 6.0E-15
sp|Q834S5|CCA_ENTFA CCA-adding enzyme OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cca PE=3 SV=1 75 302 1.0E-14
sp|Q5FKF0|CCA_LACAC CCA-adding enzyme OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=cca PE=3 SV=1 93 312 2.0E-14
sp|C5D3B5|CCA_GEOSW CCA-adding enzyme OS=Geobacillus sp. (strain WCH70) GN=cca PE=3 SV=1 93 318 2.0E-14
sp|Q02Y22|CCA_LACLS CCA-adding enzyme OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=cca PE=3 SV=1 93 302 2.0E-14
sp|Q9CFC2|CCA_LACLA CCA-adding enzyme OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=cca PE=3 SV=2 93 303 2.0E-14
sp|A2RJT1|CCA_LACLM CCA-adding enzyme OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=cca PE=3 SV=1 93 302 2.0E-14
sp|Q8Z9C3|PCNB_SALTI Poly(A) polymerase I OS=Salmonella typhi GN=pcnB PE=3 SV=2 73 322 3.0E-14
sp|Q8ZRQ8|PCNB_SALTY Poly(A) polymerase I OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pcnB PE=3 SV=2 73 322 3.0E-14
sp|A8H161|CCA_SHEPA Multifunctional CCA protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cca PE=3 SV=1 196 460 4.0E-14
sp|B1MYC1|CCA_LEUCK CCA-adding enzyme OS=Leuconostoc citreum (strain KM20) GN=cca PE=3 SV=1 93 311 4.0E-14
sp|B7GHS8|CCA_ANOFW CCA-adding enzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cca PE=3 SV=1 93 318 4.0E-14
sp|Q8DYY1|CCA_STRA5 CCA-adding enzyme OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=cca PE=3 SV=1 93 313 4.0E-14
sp|Q8E4J0|CCA_STRA3 CCA-adding enzyme OS=Streptococcus agalactiae serotype III (strain NEM316) GN=cca PE=3 SV=1 93 313 4.0E-14
sp|A8AX96|CCA_STRGC CCA-adding enzyme OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=cca PE=3 SV=1 93 300 7.0E-14
sp|Q71YB0|CCA_LISMF CCA-adding enzyme OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cca PE=3 SV=1 93 317 7.0E-14
sp|C1KWK5|CCA_LISMC CCA-adding enzyme OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=cca PE=3 SV=1 93 317 8.0E-14
sp|B8DC21|CCA_LISMH CCA-adding enzyme OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=cca PE=3 SV=1 93 317 2.0E-13
sp|Q65I54|CCA_BACLD CCA-adding enzyme OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cca PE=3 SV=1 93 321 2.0E-13
sp|Q6LV05|CCA_PHOPR Multifunctional CCA protein OS=Photobacterium profundum GN=cca PE=3 SV=1 95 364 3.0E-13
sp|Q8Y5Z8|CCA_LISMO CCA-adding enzyme OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cca PE=3 SV=1 93 317 3.0E-13
sp|Q4L6G1|CCA_STAHJ CCA-adding enzyme OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cca PE=3 SV=1 93 321 5.0E-13
sp|A3CMU4|CCA_STRSV CCA-adding enzyme OS=Streptococcus sanguinis (strain SK36) GN=cca PE=3 SV=1 70 300 6.0E-13
sp|Q7SIB1|CCA_GEOSE CCA-adding enzyme OS=Geobacillus stearothermophilus GN=cca PE=1 SV=1 93 318 8.0E-13
sp|A4IQ63|CCA_GEOTN CCA-adding enzyme OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cca PE=3 SV=1 93 317 8.0E-13
sp|B2IR74|CCA_STRPS CCA-adding enzyme OS=Streptococcus pneumoniae (strain CGSP14) GN=cca PE=3 SV=1 93 300 1.0E-12
sp|Q96Q11|TRNT1_HUMAN CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens GN=TRNT1 PE=1 SV=2 91 317 1.0E-12
sp|Q8CWQ3|CCA_STRR6 CCA-adding enzyme OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cca PE=3 SV=1 93 300 1.0E-12
sp|Q97PP9|CCA_STRPN CCA-adding enzyme OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cca PE=3 SV=2 93 300 1.0E-12
sp|Q5WGA1|CCA_BACSK CCA-adding enzyme OS=Bacillus clausii (strain KSM-K16) GN=cca PE=3 SV=1 95 338 1.0E-12
sp|B9DRX9|CCA_STRU0 CCA-adding enzyme OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=cca PE=3 SV=1 93 300 1.0E-12
sp|Q2SM94|CCA_HAHCH Multifunctional CCA protein OS=Hahella chejuensis (strain KCTC 2396) GN=cca PE=3 SV=1 95 350 2.0E-12
sp|Q92AA3|CCA_LISIN CCA-adding enzyme OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cca PE=3 SV=1 93 317 3.0E-12
sp|Q8EQD6|CCA_OCEIH CCA-adding enzyme OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cca PE=3 SV=1 93 317 3.0E-12
sp|Q8K1J6|TRNT1_MOUSE CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Mus musculus GN=Trnt1 PE=1 SV=1 91 312 4.0E-12
sp|B5E6J9|CCA_STRP4 CCA-adding enzyme OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=cca PE=3 SV=1 93 300 6.0E-12
sp|Q0HG49|CCA_SHESM Multifunctional CCA protein OS=Shewanella sp. (strain MR-4) GN=cca PE=3 SV=1 95 339 7.0E-12
sp|Q1JHE0|CCA_STRPD CCA-adding enzyme OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=cca PE=3 SV=1 93 327 1.0E-11
sp|B8CJF9|CCA_SHEPW Multifunctional CCA protein OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cca PE=3 SV=1 196 418 1.0E-11
sp|Q0HSE2|CCA_SHESR Multifunctional CCA protein OS=Shewanella sp. (strain MR-7) GN=cca PE=3 SV=1 95 339 1.0E-11
sp|Q6GGV2|CCA_STAAR CCA-adding enzyme OS=Staphylococcus aureus (strain MRSA252) GN=cca PE=3 SV=1 93 302 2.0E-11
sp|Q2Y681|CCA_NITMU Multifunctional CCA protein OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=cca PE=3 SV=1 196 306 2.0E-11
sp|Q9L7A3|CCA_HAEDU Multifunctional CCA protein OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=cca PE=3 SV=1 95 327 2.0E-11
sp|Q8CP70|CCA_STAES CCA-adding enzyme OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cca PE=3 SV=1 93 321 3.0E-11
sp|Q5HP86|CCA_STAEQ CCA-adding enzyme OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cca PE=3 SV=1 93 321 3.0E-11
sp|A0AK10|CCA_LISW6 CCA-adding enzyme OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=cca PE=3 SV=1 93 302 3.0E-11
sp|Q1J760|CCA_STRPF CCA-adding enzyme OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=cca PE=3 SV=1 93 327 3.0E-11
sp|P0DA19|CCA_STRPQ CCA-adding enzyme OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=cca PE=3 SV=1 93 327 4.0E-11
sp|Q48U40|CCA_STRPM CCA-adding enzyme OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=cca PE=3 SV=1 93 327 4.0E-11
sp|Q1JM96|CCA_STRPC CCA-adding enzyme OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=cca PE=3 SV=1 93 327 4.0E-11
sp|Q1JCB2|CCA_STRPB CCA-adding enzyme OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=cca PE=3 SV=1 93 327 4.0E-11
sp|P0DA18|CCA_STRP3 CCA-adding enzyme OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=cca PE=3 SV=1 93 327 4.0E-11
sp|C4LB55|CCA_TOLAT Multifunctional CCA protein OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cca PE=3 SV=1 95 380 4.0E-11
sp|Q9CP21|CCA_PASMU Multifunctional CCA protein OS=Pasteurella multocida (strain Pm70) GN=cca PE=3 SV=1 95 339 4.0E-11
sp|Q2YY49|CCA_STAAB CCA-adding enzyme OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cca PE=3 SV=1 93 302 6.0E-11
sp|A4SIG1|CCA_AERS4 Multifunctional CCA protein OS=Aeromonas salmonicida (strain A449) GN=cca PE=3 SV=1 95 436 6.0E-11
sp|Q31J37|CCA_THICR Multifunctional CCA protein OS=Thiomicrospira crunogena (strain XCL-2) GN=cca PE=3 SV=1 95 322 7.0E-11
sp|A8Z437|CCA_STAAT CCA-adding enzyme OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cca PE=3 SV=1 93 302 7.0E-11
sp|A6QH08|CCA_STAAE CCA-adding enzyme OS=Staphylococcus aureus (strain Newman) GN=cca PE=3 SV=1 93 302 7.0E-11
sp|Q5HFW6|CCA_STAAC CCA-adding enzyme OS=Staphylococcus aureus (strain COL) GN=cca PE=3 SV=1 93 302 7.0E-11
sp|Q8NWP0|CCA_STAAW CCA-adding enzyme OS=Staphylococcus aureus (strain MW2) GN=cca PE=3 SV=1 93 302 7.0E-11
sp|Q6G9A5|CCA_STAAS CCA-adding enzyme OS=Staphylococcus aureus (strain MSSA476) GN=cca PE=3 SV=1 93 302 7.0E-11
sp|Q07YU1|CCA_SHEFN Multifunctional CCA protein OS=Shewanella frigidimarina (strain NCIMB 400) GN=cca PE=3 SV=1 95 339 9.0E-11
sp|Q821A6|CCA_SHIFL Multifunctional CCA protein OS=Shigella flexneri GN=cca PE=3 SV=1 95 339 9.0E-11
sp|Q0T0K7|CCA_SHIF8 Multifunctional CCA protein OS=Shigella flexneri serotype 5b (strain 8401) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|Q8CXX6|CCA_ECOL6 Multifunctional CCA protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|B7UIW4|CCA_ECO27 Multifunctional CCA protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|A2RF34|CCA_STRPG CCA-adding enzyme OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=cca PE=3 SV=1 93 327 1.0E-10
sp|Q8P1E3|CCA_STRP8 CCA-adding enzyme OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=cca PE=3 SV=1 93 327 1.0E-10
sp|Q5XCN7|CCA_STRP6 CCA-adding enzyme OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cca PE=3 SV=1 93 327 1.0E-10
sp|B7N0K6|CCA_ECO81 Multifunctional CCA protein OS=Escherichia coli O81 (strain ED1a) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|A8FS72|CCA_SHESH Multifunctional CCA protein OS=Shewanella sediminis (strain HAW-EB3) GN=cca PE=3 SV=1 196 339 1.0E-10
sp|Q5KXX0|CCA_GEOKA CCA-adding enzyme OS=Geobacillus kaustophilus (strain HTA426) GN=cca PE=3 SV=1 93 318 1.0E-10
sp|B5YR96|CCA_ECO5E Multifunctional CCA protein OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|Q8XBL4|CCA_ECO57 Multifunctional CCA protein OS=Escherichia coli O157:H7 GN=cca PE=3 SV=1 95 339 1.0E-10
sp|Q0TD50|CCA_ECOL5 Multifunctional CCA protein OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|Q31WX9|CCA_SHIBS Multifunctional CCA protein OS=Shigella boydii serotype 4 (strain Sb227) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|B2U1G0|CCA_SHIB3 Multifunctional CCA protein OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|B7LZK6|CCA_ECO8A Multifunctional CCA protein OS=Escherichia coli O8 (strain IAI1) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|A7Z5Z6|CCA_BACMF CCA-adding enzyme OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cca PE=3 SV=1 93 317 1.0E-10
sp|B1LF48|CCA_ECOSM Multifunctional CCA protein OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|B7LGZ2|CCA_ECO55 Multifunctional CCA protein OS=Escherichia coli (strain 55989 / EAEC) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|A7ZRT7|CCA_ECO24 Multifunctional CCA protein OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cca PE=3 SV=1 95 339 1.0E-10
sp|Q3YXI6|CCA_SHISS Multifunctional CCA protein OS=Shigella sonnei (strain Ss046) GN=cca PE=3 SV=1 95 339 2.0E-10
sp|B4EW50|CCA_PROMH Multifunctional CCA protein OS=Proteus mirabilis (strain HI4320) GN=cca PE=3 SV=1 95 339 2.0E-10
sp|Q9A0A5|CCA_STRP1 CCA-adding enzyme OS=Streptococcus pyogenes serotype M1 GN=cca PE=3 SV=2 93 327 2.0E-10
sp|A5UCK0|CCA_HAEIE Multifunctional CCA protein OS=Haemophilus influenzae (strain PittEE) GN=cca PE=3 SV=1 95 324 2.0E-10
sp|B7LQD4|CCA_ESCF3 Multifunctional CCA protein OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cca PE=3 SV=1 95 339 2.0E-10
sp|Q7A5K2|CCA_STAAN CCA-adding enzyme OS=Staphylococcus aureus (strain N315) GN=cca PE=3 SV=1 93 302 2.0E-10
sp|Q99U32|CCA_STAAM CCA-adding enzyme OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cca PE=3 SV=1 93 302 2.0E-10
sp|A7X2F4|CCA_STAA1 CCA-adding enzyme OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cca PE=3 SV=1 93 302 2.0E-10
sp|Q1R6S5|CCA_ECOUT Multifunctional CCA protein OS=Escherichia coli (strain UTI89 / UPEC) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|A1AFX8|CCA_ECOK1 Multifunctional CCA protein OS=Escherichia coli O1:K1 / APEC GN=cca PE=3 SV=1 95 339 3.0E-10
sp|B7MAD3|CCA_ECO45 Multifunctional CCA protein OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|B8EBU8|CCA_SHEB2 Multifunctional CCA protein OS=Shewanella baltica (strain OS223) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|A4THT5|CCA_YERPP Multifunctional CCA protein OS=Yersinia pestis (strain Pestoides F) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|Q1CMD8|CCA_YERPN Multifunctional CCA protein OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|A9R7D9|CCA_YERPG Multifunctional CCA protein OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|Q8ZI64|CCA_YERPE Multifunctional CCA protein OS=Yersinia pestis GN=cca PE=3 SV=1 196 337 3.0E-10
sp|Q1C370|CCA_YERPA Multifunctional CCA protein OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|B1JM22|CCA_YERPY Multifunctional CCA protein OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|Q665U9|CCA_YERPS Multifunctional CCA protein OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|B2K2H9|CCA_YERPB Multifunctional CCA protein OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|A7FE75|CCA_YERP3 Multifunctional CCA protein OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cca PE=3 SV=1 196 337 3.0E-10
sp|B7ND45|CCA_ECOLU Multifunctional CCA protein OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|P06961|CCA_ECOLI Multifunctional CCA protein OS=Escherichia coli (strain K12) GN=cca PE=1 SV=1 95 339 3.0E-10
sp|B1IRR0|CCA_ECOLC Multifunctional CCA protein OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|A8A4L0|CCA_ECOHS Multifunctional CCA protein OS=Escherichia coli O9:H4 (strain HS) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|B1XG61|CCA_ECODH Multifunctional CCA protein OS=Escherichia coli (strain K12 / DH10B) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|C4ZQX3|CCA_ECOBW Multifunctional CCA protein OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cca PE=3 SV=1 95 339 3.0E-10
sp|A7GN74|CCA_BACCN CCA-adding enzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=cca PE=3 SV=1 93 339 3.0E-10
sp|B7NJR9|CCA_ECO7I Multifunctional CCA protein OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cca PE=3 SV=1 95 339 4.0E-10
sp|A3D1R1|CCA_SHEB5 Multifunctional CCA protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cca PE=3 SV=1 95 339 4.0E-10
sp|A6WKL1|CCA_SHEB8 Multifunctional CCA protein OS=Shewanella baltica (strain OS185) GN=cca PE=3 SV=1 95 339 4.0E-10
sp|A9L5J0|CCA_SHEB9 Multifunctional CCA protein OS=Shewanella baltica (strain OS195) GN=cca PE=3 SV=1 196 339 4.0E-10
sp|B1KHF1|CCA_SHEWM Multifunctional CCA protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cca PE=3 SV=1 196 339 5.0E-10
sp|Q49XR3|CCA_STAS1 CCA-adding enzyme OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cca PE=3 SV=1 93 309 5.0E-10
sp|B6I427|CCA_ECOSE Multifunctional CCA protein OS=Escherichia coli (strain SE11) GN=cca PE=3 SV=1 95 339 6.0E-10
sp|Q82U82|CCA_NITEU Multifunctional CCA protein OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cca PE=3 SV=1 95 340 6.0E-10
sp|Q0AIP2|CCA_NITEC Multifunctional CCA protein OS=Nitrosomonas eutropha (strain C91) GN=cca PE=3 SV=1 196 340 7.0E-10
sp|Q1G9U3|CCA_LACDA CCA-adding enzyme OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=cca PE=3 SV=1 93 303 7.0E-10
sp|Q32BQ8|CCA_SHIDS Multifunctional CCA protein OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cca PE=3 SV=1 95 339 9.0E-10
sp|B9IVQ9|CCA_BACCQ CCA-adding enzyme OS=Bacillus cereus (strain Q1) GN=cca PE=3 SV=1 93 338 9.0E-10
sp|P45749|CCA_AERHY CCA-adding enzyme (Fragment) OS=Aeromonas hydrophila GN=cca PE=3 SV=1 95 305 1.0E-09
sp|Q89B06|CCA_BUCBP CCA-adding enzyme OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=cca PE=3 SV=1 94 322 1.0E-09
sp|A0KZT1|CCA_SHESA Multifunctional CCA protein OS=Shewanella sp. (strain ANA-3) GN=cca PE=3 SV=1 196 339 1.0E-09
sp|Q7U350|CCA_BLOFL CCA-adding enzyme OS=Blochmannia floridanus GN=cca PE=3 SV=1 196 352 1.0E-09
sp|A8APT7|CCA_CITK8 Multifunctional CCA protein OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cca PE=3 SV=1 95 339 1.0E-09
sp|Q493X4|CCA_BLOPB CCA-adding enzyme OS=Blochmannia pennsylvanicus (strain BPEN) GN=cca PE=3 SV=1 196 312 2.0E-09
sp|Q9PDL7|CCA_XYLFA Multifunctional CCA protein OS=Xylella fastidiosa (strain 9a5c) GN=cca PE=3 SV=1 196 358 2.0E-09
sp|Q049Z4|CCA_LACDB CCA-adding enzyme OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=cca PE=3 SV=1 93 303 2.0E-09
sp|Q7U358|CCA_BORPE CCA-adding enzyme OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cca PE=3 SV=1 95 337 2.0E-09
sp|A0KPN1|CCA_AERHH Multifunctional CCA protein OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cca PE=3 SV=1 95 436 2.0E-09
sp|B3GXR2|CCA_ACTP7 Multifunctional CCA protein OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cca PE=3 SV=1 95 337 4.0E-09
sp|A3N0S5|CCA_ACTP2 Multifunctional CCA protein OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cca PE=3 SV=1 95 337 4.0E-09
sp|Q7MBF4|CCA_CHRVO Multifunctional CCA protein OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cca PE=3 SV=1 196 429 4.0E-09
sp|A6VN94|CCA_ACTSZ CCA-adding enzyme OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cca PE=3 SV=1 196 316 4.0E-09
sp|A4WEI8|CCA_ENT38 Multifunctional CCA protein OS=Enterobacter sp. (strain 638) GN=cca PE=3 SV=1 95 339 4.0E-09
sp|B5XU35|CCA_KLEP3 Multifunctional CCA protein OS=Klebsiella pneumoniae (strain 342) GN=cca PE=3 SV=1 95 339 7.0E-09
sp|A6TE35|CCA_KLEP7 Multifunctional CCA protein OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cca PE=3 SV=1 95 339 9.0E-09
sp|Q9JUB2|CCA_NEIMA Multifunctional CCA protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cca PE=3 SV=1 196 335 1.0E-08
sp|A9LZC1|CCA_NEIM0 Multifunctional CCA protein OS=Neisseria meningitidis serogroup C (strain 053442) GN=cca PE=3 SV=1 196 335 1.0E-08
sp|Q9JZ88|CCA_NEIMB Multifunctional CCA protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=cca PE=3 SV=1 196 335 1.0E-08
sp|B4RLV5|CCA_NEIG2 Multifunctional CCA protein OS=Neisseria gonorrhoeae (strain NCCP11945) GN=cca PE=3 SV=1 196 335 1.0E-08
sp|Q5F8K9|CCA_NEIG1 Multifunctional CCA protein OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=cca PE=3 SV=1 196 335 2.0E-08
sp|A1JQW2|CCA_YERE8 Multifunctional CCA protein OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cca PE=3 SV=1 196 355 2.0E-08
sp|Q3JE31|CCA_NITOC Multifunctional CCA protein OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cca PE=3 SV=1 196 339 2.0E-08
sp|Q12KC4|CCA_SHEDO Multifunctional CCA protein OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cca PE=3 SV=1 95 436 2.0E-08
sp|A1KU50|CCA_NEIMF Multifunctional CCA protein OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cca PE=3 SV=1 196 335 3.0E-08
sp|Q8CWL6|CCA_VIBVU Multifunctional CCA protein OS=Vibrio vulnificus (strain CMCP6) GN=cca PE=3 SV=2 95 339 4.0E-08
sp|Q2NWE2|CCA_SODGM Multifunctional CCA protein OS=Sodalis glossinidius (strain morsitans) GN=cca PE=3 SV=1 95 339 4.0E-08
sp|A9N5Y2|CCA_SALPB Multifunctional CCA protein OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cca PE=3 SV=1 95 339 5.0E-08
sp|Q7M7K5|CCA_VIBVY Multifunctional CCA protein OS=Vibrio vulnificus (strain YJ016) GN=cca PE=3 SV=2 95 339 5.0E-08
sp|Q6D160|CCA_PECAS Multifunctional CCA protein OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cca PE=3 SV=1 196 339 6.0E-08
sp|A7MWN9|CCA_VIBCB Multifunctional CCA protein OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cca PE=3 SV=1 95 339 8.0E-08
sp|Q5X1E5|CCA_LEGPA Multifunctional CCA protein OS=Legionella pneumophila (strain Paris) GN=cca PE=3 SV=1 95 327 1.0E-07
sp|B5BG15|CCA_SALPK Multifunctional CCA protein OS=Salmonella paratyphi A (strain AKU_12601) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|Q5PC82|CCA_SALPA Multifunctional CCA protein OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|Q8Z3M9|CCA_SALTI Multifunctional CCA protein OS=Salmonella typhi GN=cca PE=3 SV=1 95 339 1.0E-07
sp|B4TVT8|CCA_SALSV Multifunctional CCA protein OS=Salmonella schwarzengrund (strain CVM19633) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|C0PYX7|CCA_SALPC Multifunctional CCA protein OS=Salmonella paratyphi C (strain RKS4594) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|Q57JQ5|CCA_SALCH Multifunctional CCA protein OS=Salmonella choleraesuis (strain SC-B67) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|B4T674|CCA_SALNS Multifunctional CCA protein OS=Salmonella newport (strain SL254) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|B4TI55|CCA_SALHS Multifunctional CCA protein OS=Salmonella heidelberg (strain SL476) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|B5REG2|CCA_SALG2 Multifunctional CCA protein OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|B5QZ40|CCA_SALEP Multifunctional CCA protein OS=Salmonella enteritidis PT4 (strain P125109) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|B5FHT9|CCA_SALDC Multifunctional CCA protein OS=Salmonella dublin (strain CT_02021853) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|B5F6A0|CCA_SALA4 Multifunctional CCA protein OS=Salmonella agona (strain SL483) GN=cca PE=3 SV=1 95 339 1.0E-07
sp|Q5ZRX9|CCA_LEGPH Multifunctional CCA protein OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=cca PE=3 SV=2 95 327 2.0E-07
sp|Q5WT58|CCA_LEGPL Multifunctional CCA protein OS=Legionella pneumophila (strain Lens) GN=cca PE=3 SV=1 95 327 2.0E-07
sp|Q5E2K7|CCA_VIBF1 Multifunctional CCA protein OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cca PE=3 SV=1 196 339 2.0E-07
sp|B1JDY1|CCA_PSEPW CCA-adding enzyme OS=Pseudomonas putida (strain W619) GN=cca PE=3 SV=1 196 310 2.0E-07
sp|Q8ZLY4|CCA_SALTY Multifunctional CCA protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cca PE=3 SV=1 95 339 2.0E-07
sp|A1SRC9|CCA_PSYIN Multifunctional CCA protein OS=Psychromonas ingrahamii (strain 37) GN=cca PE=3 SV=1 95 339 3.0E-07
sp|Q2NZ41|CCA_XANOM Multifunctional CCA protein OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cca PE=3 SV=1 196 372 3.0E-07
sp|B2FUP5|CCA_STRMK Multifunctional CCA protein OS=Stenotrophomonas maltophilia (strain K279a) GN=cca PE=3 SV=1 196 312 4.0E-07
sp|A6T2Y3|CCA_JANMA Multifunctional CCA protein OS=Janthinobacterium sp. (strain Marseille) GN=cca PE=3 SV=1 196 312 4.0E-07
sp|Q1LSL7|CCA_BAUCH Multifunctional CCA protein OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cca PE=3 SV=1 196 339 5.0E-07
sp|B4RVV4|CCA_ALTMD CCA-adding enzyme OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cca PE=3 SV=1 196 314 6.0E-07
sp|Q5QY23|CCA_IDILO CCA-adding enzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cca PE=3 SV=1 95 312 7.0E-07
sp|B5FB77|CCA_VIBFM Multifunctional CCA protein OS=Vibrio fischeri (strain MJ11) GN=cca PE=3 SV=1 95 339 7.0E-07
sp|Q4K4W8|CCA_PSEF5 Multifunctional CCA protein OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cca PE=3 SV=1 95 335 8.0E-07
sp|A4G969|CCA_HERAR Multifunctional CCA protein OS=Herminiimonas arsenicoxydans GN=cca PE=3 SV=1 196 310 9.0E-07
sp|B4SIY9|CCA_STRM5 Multifunctional CCA protein OS=Stenotrophomonas maltophilia (strain R551-3) GN=cca PE=3 SV=1 196 312 9.0E-07
sp|A7MJU1|CCA_CROS8 Multifunctional CCA protein OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cca PE=3 SV=1 95 339 1.0E-06
sp|B8GUR8|CCA_THISH Multifunctional CCA protein OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cca PE=3 SV=1 196 312 1.0E-06
sp|C3LQY9|CCA_VIBCM Multifunctional CCA protein OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cca PE=3 SV=1 196 364 1.0E-06
sp|Q9KPC6|CCA_VIBCH Multifunctional CCA protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cca PE=3 SV=1 196 364 1.0E-06
sp|A9KEZ9|CCA_COXBN CCA-adding enzyme OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cca PE=3 SV=1 199 324 2.0E-06
sp|Q820V9|CCA_COXBU CCA-adding enzyme OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cca PE=3 SV=1 199 324 3.0E-06
sp|A9NAS1|CCA_COXBR CCA-adding enzyme OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cca PE=3 SV=1 199 324 3.0E-06
sp|Q8KA53|CCA_BUCAP CCA-adding enzyme OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cca PE=3 SV=1 196 337 3.0E-06
sp|B2VGJ4|CCA_ERWT9 Multifunctional CCA protein OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cca PE=3 SV=1 196 339 3.0E-06
sp|Q0VMU8|CCA_ALCBS Multifunctional CCA protein OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cca PE=3 SV=1 95 324 4.0E-06
sp|C1DAG2|CCA_LARHH Multifunctional CCA protein OS=Laribacter hongkongensis (strain HLHK9) GN=cca PE=3 SV=1 196 305 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0003723 RNA binding Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4811
MILRRYSLAICPATVKRKLGLMVPPTLLRHRAESLEQHNTTTTNAVGPANKPIPPLPVLSLNAREQQLRQLLLHV
CKSIDATGKWEEPLVLRWAGGWVRDKLLGVESHDIDVAINTMTGLEFAESMCEICSSEVLTGLGLATDDLRKPHK
IARNPEKSKHLETATVRILGLDVDFVDLRRETYAADSRNPVVERGTARQDAFRRDATINALFYNIHDNCIEDFTC
GLSDLENCIIRTPLEPLQTFTDDPLRVLRLIRFASRLKFAIDPETEKLMDHAGVLDALRVKISRERVGIELEKML
KGEYPCAALQLIDRLNLYHAIFTDPHQTALMRPEMTRWHVAYNCLSSLMAERSHPGSVGNLLVRADHDIYAAWNL
AALSPWMTIQDVLDGLEKGKPPLPLVAVVARNGFRAPNKLFDLVAASQRHMKEIIELKTAVCSQQDWVRERDKLG
MIVRRWDSRGGSWTLQVLNALLVDAMEQLETWSDRDCQHFLAYWQQFLDHLGKIQVYNAHTIKPLVDGHMLARSM
QVKPGKWMVKALDVCMAWQLRNPDVKDASGAIDEVHRRRHELGIPE*
Coding >OphauB2|4811
ATGATCCTTCGACGATATAGCCTGGCTATCTGCCCTGCCACAGTGAAGCGCAAGCTGGGACTTATGGTTCCACCA
ACGCTACTTCGGCACCGTGCCGAGAGCCTAGAGCAGCACAACACTACCACTACCAACGCTGTCGGGCCTGCAAAC
AAACCAATACCGCCTCTCCCTGTGTTGTCTCTGAACGCGCGTGAACAGCAGCTGCGCCAACTGTTGCTCCATGTC
TGCAAGTCGATTGATGCTACTGGGAAATGGGAGGAACCTCTCGTCTTACGCTGGGCTGGTGGTTGGGTTCGCGAC
AAACTGCTCGGTGTAGAGAGTCATGACATTGACGTGGCCATCAACACGATGACGGGACTTGAATTTGCTGAGAGT
ATGTGCGAAATATGCTCCTCGGAAGTCTTGACTGGATTGGGCCTGGCCACCGATGACTTGAGGAAGCCCCACAAG
ATCGCCCGCAACCCTGAAAAATCCAAGCATCTTGAGACTGCCACGGTTCGCATCCTGGGCCTTGATGTCGACTTT
GTCGACTTACGCCGCGAAACGTATGCTGCGGATAGTCGCAACCCAGTCGTTGAACGCGGCACTGCGCGCCAAGAT
GCGTTCCGGCGCGATGCAACTATTAATGCCCTCTTTTACAATATTCATGATAACTGCATTGAAGATTTTACTTGT
GGTCTATCTGATCTCGAAAACTGCATCATTCGTACACCACTGGAACCTCTGCAAACATTTACGGATGACCCGCTT
CGCGTCCTCCGTCTCATCCGCTTTGCCAGCCGCCTGAAATTCGCCATCGACCCAGAAACAGAAAAACTTATGGAC
CATGCAGGCGTTCTTGACGCACTTCGTGTCAAAATCAGTCGTGAAAGGGTGGGTATCGAGCTTGAAAAGATGCTC
AAAGGGGAATATCCTTGCGCGGCATTACAGCTCATTGACAGGCTTAACCTTTACCACGCCATATTTACCGATCCA
CATCAAACAGCTCTGATGAGGCCCGAGATGACTCGCTGGCATGTAGCTTACAACTGTCTCAGCAGCCTCATGGCT
GAACGCAGTCATCCGGGCTCGGTCGGCAATTTACTAGTCCGAGCCGACCACGATATCTATGCCGCCTGGAATTTA
GCGGCACTCAGTCCCTGGATGACAATTCAAGACGTACTAGACGGCCTCGAGAAGGGAAAGCCTCCCTTGCCTCTA
GTCGCCGTGGTAGCACGGAATGGCTTCAGGGCCCCGAATAAGCTTTTTGACCTCGTGGCAGCGAGTCAGCGCCAC
ATGAAGGAAATCATTGAACTCAAGACAGCCGTATGTAGCCAACAGGATTGGGTACGCGAGCGCGACAAACTGGGA
ATGATAGTTCGTCGATGGGACTCTAGAGGCGGCTCTTGGACTCTCCAAGTGCTGAATGCGCTGCTTGTTGATGCC
ATGGAACAGTTGGAAACATGGTCGGACCGCGACTGCCAACACTTTCTCGCATATTGGCAACAATTTTTAGACCAT
TTGGGAAAAATCCAAGTTTATAATGCTCATACTATAAAGCCGCTCGTTGACGGCCACATGCTGGCACGTTCAATG
CAAGTTAAACCAGGCAAATGGATGGTTAAAGCTCTGGACGTATGCATGGCATGGCAGCTACGGAATCCGGATGTA
AAGGATGCGAGCGGCGCCATAGACGAGGTACATCGAAGGCGACACGAGCTTGGTATACCTGAATGA
Transcript >OphauB2|4811
ATGATCCTTCGACGATATAGCCTGGCTATCTGCCCTGCCACAGTGAAGCGCAAGCTGGGACTTATGGTTCCACCA
ACGCTACTTCGGCACCGTGCCGAGAGCCTAGAGCAGCACAACACTACCACTACCAACGCTGTCGGGCCTGCAAAC
AAACCAATACCGCCTCTCCCTGTGTTGTCTCTGAACGCGCGTGAACAGCAGCTGCGCCAACTGTTGCTCCATGTC
TGCAAGTCGATTGATGCTACTGGGAAATGGGAGGAACCTCTCGTCTTACGCTGGGCTGGTGGTTGGGTTCGCGAC
AAACTGCTCGGTGTAGAGAGTCATGACATTGACGTGGCCATCAACACGATGACGGGACTTGAATTTGCTGAGAGT
ATGTGCGAAATATGCTCCTCGGAAGTCTTGACTGGATTGGGCCTGGCCACCGATGACTTGAGGAAGCCCCACAAG
ATCGCCCGCAACCCTGAAAAATCCAAGCATCTTGAGACTGCCACGGTTCGCATCCTGGGCCTTGATGTCGACTTT
GTCGACTTACGCCGCGAAACGTATGCTGCGGATAGTCGCAACCCAGTCGTTGAACGCGGCACTGCGCGCCAAGAT
GCGTTCCGGCGCGATGCAACTATTAATGCCCTCTTTTACAATATTCATGATAACTGCATTGAAGATTTTACTTGT
GGTCTATCTGATCTCGAAAACTGCATCATTCGTACACCACTGGAACCTCTGCAAACATTTACGGATGACCCGCTT
CGCGTCCTCCGTCTCATCCGCTTTGCCAGCCGCCTGAAATTCGCCATCGACCCAGAAACAGAAAAACTTATGGAC
CATGCAGGCGTTCTTGACGCACTTCGTGTCAAAATCAGTCGTGAAAGGGTGGGTATCGAGCTTGAAAAGATGCTC
AAAGGGGAATATCCTTGCGCGGCATTACAGCTCATTGACAGGCTTAACCTTTACCACGCCATATTTACCGATCCA
CATCAAACAGCTCTGATGAGGCCCGAGATGACTCGCTGGCATGTAGCTTACAACTGTCTCAGCAGCCTCATGGCT
GAACGCAGTCATCCGGGCTCGGTCGGCAATTTACTAGTCCGAGCCGACCACGATATCTATGCCGCCTGGAATTTA
GCGGCACTCAGTCCCTGGATGACAATTCAAGACGTACTAGACGGCCTCGAGAAGGGAAAGCCTCCCTTGCCTCTA
GTCGCCGTGGTAGCACGGAATGGCTTCAGGGCCCCGAATAAGCTTTTTGACCTCGTGGCAGCGAGTCAGCGCCAC
ATGAAGGAAATCATTGAACTCAAGACAGCCGTATGTAGCCAACAGGATTGGGTACGCGAGCGCGACAAACTGGGA
ATGATAGTTCGTCGATGGGACTCTAGAGGCGGCTCTTGGACTCTCCAAGTGCTGAATGCGCTGCTTGTTGATGCC
ATGGAACAGTTGGAAACATGGTCGGACCGCGACTGCCAACACTTTCTCGCATATTGGCAACAATTTTTAGACCAT
TTGGGAAAAATCCAAGTTTATAATGCTCATACTATAAAGCCGCTCGTTGACGGCCACATGCTGGCACGTTCAATG
CAAGTTAAACCAGGCAAATGGATGGTTAAAGCTCTGGACGTATGCATGGCATGGCAGCTACGGAATCCGGATGTA
AAGGATGCGAGCGGCGCCATAGACGAGGTACATCGAAGGCGACACGAGCTTGGTATACCTGAATGA
Gene >OphauB2|4811
ATGATCCTTCGACGATATAGCCTGGCTATCTGCCCTGCCACAGTGAAGCGCAAGCTGGGACTTATGGTTCCACCA
ACGCTACTTCGGCACCGTGCCGAGAGCCTAGAGCAGCACAACACTACCACTACCAACGCTGTCGGGCCTGCAAAC
AAACCAATACCGCCTCTCCCTGTGTTGTCTCTGAACGCGCGTGAACAGCAGCTGCGCCAACTGTTGCTCCATGTC
TGCAAGTCGATTGATGCTACTGGGAAATGGGAGGAACCTCTCGTCTTACGCTGGGCTGGTGGTTGGGTTCGCGAC
AAACTGCTCGGTGTAGAGAGTCATGACATTGACGTGGCCATCAACACGATGACGGGACTTGAATTTGCTGAGAGT
ATGTGCGAAATATGCTCCTCGGAAGTCTTGACTGGATTGGGCCTGGCCACCGATGACTTGAGGAAGCCCCACAAG
ATCGCCCGCAACCCTGAAAAATCCAAGCATCTTGAGACTGCCACGGTTCGCATCCTGGGCCTTGATGTCGACTTT
GTCGACTTACGCCGCGAAACGTATGCTGCGGATAGTCGCAACCCAGTCGTTGAACGCGGCACTGCGCGCCAAGAT
GCGTTCCGGCGCGATGCAACTATTAATGCCCTCTTTTACAATATTCATGATAACTGCATTGAAGATTTTACTTGT
GGTCTATCTGATCTCGAAAACTGCATCATTCGTACACCACTGGAACCTCTGCAAACATTTACGGATGACCCGCTT
CGCGTCCTCCGTCTCATCCGCTTTGCCAGCCGCCTGAAATTCGCCATCGACCCAGAAACAGAAAAACTTATGGAC
CATGCAGGCGTTCTTGACGCACTTCGTGTCAAAATCAGTCGTGAAAGGGTGGGTATCGAGCTTGAAAAGATGCTC
AAAGGTACTGACGCCTATCTCTTCCAGTATGGCTGGCTACTAACTTCGTACGGACAGGGGAATATCCTTGCGCGG
CATTACAGCTCATTGACAGGCTTAACCTTTACCACGCCATATTTACCGATCCACATCAAACAGCTCTGATGAGGC
CCGAGATGACTCGCTGGCATGTAGCTTACAACTGTCTCAGCAGCCTCATGGCTGAACGCAGTCATCCGGGCTCGG
TCGGCAATTTACTAGTCCGAGCCGACCACGATATCTATGCCGCCTGGAATTTAGCGGCACTCAGTCCCTGGATGA
CAATTCAAGACGTACTAGACGGCCTCGAGAAGGGAAAGCCTCCCTTGCCTCTAGTCGCCGTGGTAGCACGGAATG
GCTTCAGGGCCCCGAATAAGCTTTTTGACCTCGTGGCAGCGAGTCAGCGCCACATGAAGGAAATCATTGAACTCA
AGACAGCCGTATGTAGCCAACAGGATTGGGTACGCGAGCGCGACAAACTGGGAATGATAGTTCGTCGATGGGACT
CTAGAGGCGGCTCTTGGACTCTCCAAGTGCTGAATGCGCTGCTTGTTGATGCCATGGAACAGTTGGAAACATGGT
CGGACCGCGGTTTGTGTGACTTTTGAGCTCTGTGTCGACCAGATGCTAACAATTCTGTGGAAAACAGACTGCCAA
CACTTTCTCGCATATTGGCAACAATTTTTAGACCATTTGGGAAAAATCCAAGTTTATAATGCTCATACTATAAAG
CCGCTCGTTGACGGCCACATGCTGGCACGTTCAATGCAAGTTAAACCAGGCAAATGGATGGTTAAAGCTCTGGAC
GTATGCATGGCATGGCAGCTACGGAATCCGGATGTAAAGGATGCGAGCGGCGCCATAGACGAGGTACATCGAAGG
CGACACGAGCTTGGTATACCTGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail