Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|480
Gene name
LocationContig_107:66155..67664
Strand-
Gene length (bp)1509
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.9E-14 11 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 49 451 4.0E-46
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 49 451 5.0E-46
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 49 451 7.0E-44
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 49 451 8.0E-44
sp|Q39085|DIM_ARATH Delta(24)-sterol reductase OS=Arabidopsis thaliana GN=DIM PE=1 SV=2 2 452 6.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 49 451 4.0E-46
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 49 451 5.0E-46
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 49 451 7.0E-44
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 49 451 8.0E-44
sp|Q39085|DIM_ARATH Delta(24)-sterol reductase OS=Arabidopsis thaliana GN=DIM PE=1 SV=2 2 452 6.0E-38
sp|O17397|DIML_CAEEL Diminuto-like protein OS=Caenorhabditis elegans GN=F52H2.6 PE=3 SV=1 38 451 8.0E-34
sp|P93472|DIM_PEA Delta(24)-sterol reductase OS=Pisum sativum GN=DIM PE=1 SV=1 30 452 2.0E-33
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 72 222 7.0E-14
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 72 222 6.0E-13
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 4 230 4.0E-12
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 71 203 4.0E-12
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 72 173 8.0E-11
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 72 173 6.0E-10
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 72 173 6.0E-10
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 11 173 1.0E-09
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 72 206 2.0E-09
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 43 165 2.0E-09
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 73 206 1.0E-08
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 7 222 3.0E-08
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 62 208 7.0E-08
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 39 206 8.0E-08
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 73 203 1.0E-07
sp|A0R607|DPRE1_MYCS2 FAD-dependent decaprenylphosphoryl-beta-D-ribofuranose 2-oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dprE1 PE=1 SV=2 43 154 2.0E-07
sp|Q0JQ12|CKX1_ORYSJ Cytokinin dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CKX1 PE=3 SV=2 73 212 2.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 43 203 3.0E-07
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 11 179 3.0E-07
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 73 200 5.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 67 203 1.0E-06
sp|Q9T0N8|CKX1_MAIZE Cytokinin dehydrogenase 1 OS=Zea mays GN=CKX1 PE=1 SV=2 73 173 1.0E-06
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 49 194 3.0E-06
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 43 162 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0048037 cofactor binding No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|480
MERHKEAVGRIAAAVRGFFERKESFRIFHGSTNSTRPRPNTRVVDISALSHVVAVDRSARTALVEPNVPMDKLVE
ATLREGLVPPVVMEFPGITAGGGFAGTAGESSSFRHGFFSDTVDSVEMVLGNGDVVSASPAERADLFGAAAGAVG
SLGITTMMRLRLVEAKRWVRTTYYRTSSVAEAIARVRAETQDPANDYVDGIIFSERHGTVITGRMTDDRPEDCPP
QTFSGARDPWFYLHAEARTAAQPEATDYIPLAEYLFRYDRGGFWVGTQGWTYFKCLPFNRFTRWLLDDFMHTRML
YRALHASGESARFIIQDLTLPYAKAEEFIHYTTRQFAIWPLWLCPLKQTPPPTFHPFTGETDPASAKPSDMLNVG
LWGWGPDDHETFIAKNRALEDELVRLGGRKILYAHTYYTQDEFWRVYNQHSDTRAWYEALREKYHATTLPTVYEK
VRIDIDAARRDCAKWRASFTGRRPIPGLYGVYKSIQSGDYGLHRNAGWKFKE*
Coding >OphauB2|480
ATGGAGCGCCACAAAGAGGCCGTCGGCAGGATCGCGGCGGCGGTGCGCGGCTTCTTTGAGCGCAAGGAGTCGTTT
CGCATCTTCCACGGCAGCACCAACAGCACCCGGCCACGGCCCAATACACGCGTCGTCGACATTAGCGCCCTGTCG
CACGTGGTGGCTGTGGATCGCAGCGCGCGTACCGCCCTGGTTGAGCCCAACGTGCCCATGGACAAGCTGGTCGAG
GCGACGCTGCGCGAGGGCCTGGTGCCGCCTGTTGTCATGGAGTTTCCCGGTATTACAGCTGGCGGCGGCTTCGCG
GGCACTGCGGGCGAGAGCTCGTCCTTTCGGCACGGCTTCTTCAGCGATACCGTCGATTCCGTTGAAATGGTGCTG
GGCAACGGCGACGTCGTCTCGGCCTCGCCTGCTGAGCGCGCCGACTTGTTTGGTGCTGCTGCGGGCGCTGTCGGC
AGCCTGGGCATTACTACCATGATGCGGCTCCGTCTGGTCGAGGCCAAGCGCTGGGTGCGCACCACTTACTACCGC
ACGTCGAGCGTTGCCGAGGCTATAGCCCGCGTTCGCGCCGAGACGCAGGACCCGGCCAATGACTATGTCGACGGC
ATCATCTTCTCGGAGCGCCATGGCACCGTCATTACCGGCCGCATGACGGACGACCGCCCCGAAGACTGTCCGCCG
CAGACGTTTAGCGGCGCTCGCGACCCCTGGTTCTATCTCCACGCCGAGGCGCGCACAGCCGCCCAGCCCGAGGCC
ACCGACTACATTCCCCTTGCCGAGTATCTCTTCCGCTACGACCGCGGCGGCTTCTGGGTCGGCACCCAGGGCTGG
ACCTACTTCAAGTGCCTGCCCTTTAACCGCTTCACTCGCTGGCTGCTCGACGACTTTATGCACACGCGCATGCTC
TACCGCGCCCTCCACGCCAGCGGCGAGTCGGCCCGCTTCATCATCCAGGACCTGACCTTGCCCTACGCCAAGGCT
GAAGAGTTTATCCACTACACCACCCGCCAGTTTGCCATTTGGCCTCTCTGGCTGTGCCCCCTCAAGCAGACGCCG
CCGCCCACCTTTCACCCTTTTACTGGAGAGACGGATCCGGCCTCGGCCAAGCCCAGCGACATGCTCAACGTTGGC
CTCTGGGGCTGGGGGCCCGACGACCACGAGACCTTTATTGCCAAGAACCGCGCGCTCGAGGACGAGCTGGTGCGC
CTGGGCGGCCGCAAAATCCTCTACGCCCACACCTACTACACCCAAGACGAGTTTTGGCGCGTCTACAACCAGCAC
TCGGACACTAGGGCCTGGTACGAGGCGCTGCGGGAAAAGTACCACGCCACCACGCTGCCCACTGTTTACGAAAAG
GTGCGCATCGACATTGACGCTGCCCGCCGTGACTGCGCCAAGTGGCGCGCCTCGTTTACGGGCAGGCGGCCCATT
CCCGGCCTGTACGGGGTATACAAGAGCATCCAGAGCGGCGACTATGGCCTCCACCGCAATGCCGGGTGGAAGTTT
AAGGAGTAG
Transcript >OphauB2|480
ATGGAGCGCCACAAAGAGGCCGTCGGCAGGATCGCGGCGGCGGTGCGCGGCTTCTTTGAGCGCAAGGAGTCGTTT
CGCATCTTCCACGGCAGCACCAACAGCACCCGGCCACGGCCCAATACACGCGTCGTCGACATTAGCGCCCTGTCG
CACGTGGTGGCTGTGGATCGCAGCGCGCGTACCGCCCTGGTTGAGCCCAACGTGCCCATGGACAAGCTGGTCGAG
GCGACGCTGCGCGAGGGCCTGGTGCCGCCTGTTGTCATGGAGTTTCCCGGTATTACAGCTGGCGGCGGCTTCGCG
GGCACTGCGGGCGAGAGCTCGTCCTTTCGGCACGGCTTCTTCAGCGATACCGTCGATTCCGTTGAAATGGTGCTG
GGCAACGGCGACGTCGTCTCGGCCTCGCCTGCTGAGCGCGCCGACTTGTTTGGTGCTGCTGCGGGCGCTGTCGGC
AGCCTGGGCATTACTACCATGATGCGGCTCCGTCTGGTCGAGGCCAAGCGCTGGGTGCGCACCACTTACTACCGC
ACGTCGAGCGTTGCCGAGGCTATAGCCCGCGTTCGCGCCGAGACGCAGGACCCGGCCAATGACTATGTCGACGGC
ATCATCTTCTCGGAGCGCCATGGCACCGTCATTACCGGCCGCATGACGGACGACCGCCCCGAAGACTGTCCGCCG
CAGACGTTTAGCGGCGCTCGCGACCCCTGGTTCTATCTCCACGCCGAGGCGCGCACAGCCGCCCAGCCCGAGGCC
ACCGACTACATTCCCCTTGCCGAGTATCTCTTCCGCTACGACCGCGGCGGCTTCTGGGTCGGCACCCAGGGCTGG
ACCTACTTCAAGTGCCTGCCCTTTAACCGCTTCACTCGCTGGCTGCTCGACGACTTTATGCACACGCGCATGCTC
TACCGCGCCCTCCACGCCAGCGGCGAGTCGGCCCGCTTCATCATCCAGGACCTGACCTTGCCCTACGCCAAGGCT
GAAGAGTTTATCCACTACACCACCCGCCAGTTTGCCATTTGGCCTCTCTGGCTGTGCCCCCTCAAGCAGACGCCG
CCGCCCACCTTTCACCCTTTTACTGGAGAGACGGATCCGGCCTCGGCCAAGCCCAGCGACATGCTCAACGTTGGC
CTCTGGGGCTGGGGGCCCGACGACCACGAGACCTTTATTGCCAAGAACCGCGCGCTCGAGGACGAGCTGGTGCGC
CTGGGCGGCCGCAAAATCCTCTACGCCCACACCTACTACACCCAAGACGAGTTTTGGCGCGTCTACAACCAGCAC
TCGGACACTAGGGCCTGGTACGAGGCGCTGCGGGAAAAGTACCACGCCACCACGCTGCCCACTGTTTACGAAAAG
GTGCGCATCGACATTGACGCTGCCCGCCGTGACTGCGCCAAGTGGCGCGCCTCGTTTACGGGCAGGCGGCCCATT
CCCGGCCTGTACGGGGTATACAAGAGCATCCAGAGCGGCGACTATGGCCTCCACCGCAATGCCGGGTGGAAGTTT
AAGGAGTAG
Gene >OphauB2|480
ATGGAGCGCCACAAAGAGGCCGTCGGCAGGATCGCGGCGGCGGTGCGCGGCTTCTTTGAGCGCAAGGAGTCGTTT
CGCATCTTCCACGGCAGCACCAACAGCACCCGGCCACGGCCCAATACACGCGTCGTCGACATTAGCGCCCTGTCG
CACGTGGTGGCTGTGGATCGCAGCGCGCGTACCGCCCTGGTTGAGCCCAACGTGCCCATGGACAAGCTGGTCGAG
GCGACGCTGCGCGAGGGCCTGGTGCCGCCTGTTGTCATGGAGTTTCCCGGTATTACAGCTGGCGGCGGCTTCGCG
GGCACTGCGGGCGAGAGCTCGTCCTTTCGGCACGGCTTCTTCAGCGATACCGTCGATTCCGTTGAAATGGTGCTG
GGCAACGGCGACGTCGTCTCGGCCTCGCCTGCTGAGCGCGCCGACTTGTTTGGTGCTGCTGCGGGCGCTGTCGGC
AGCCTGGGCATTACTACCATGATGCGGCTCCGTCTGGTCGAGGCCAAGCGCTGGGTGCGCACCACTTACTACCGC
ACGTCGAGCGTTGCCGAGGCTATAGCCCGCGTTCGCGCCGAGACGCAGGACCCGGCCAATGACTATGTCGACGGC
ATCATCTTCTCGGAGCGCCATGGCACCGTCATTACCGGCCGCATGACGGACGACCGCCCCGAAGACTGTCCGCCG
CAGACGTTTAGCGGCGCTCGCGACCCCTGGTTCTATCTCCACGCCGAGGCGCGCACAGCCGCCCAGCCCGAGGCC
ACCGACTACATTCCCCTTGCCGAGTATCTCTTCCGCTACGACCGCGGCGGCTTCTGGGTCGGCACCCAGGGCTGG
ACCTACTTCAAGTGCCTGCCCTTTAACCGCTTCACTCGCTGGCTGCTCGACGACTTTATGCACACGCGCATGCTC
TACCGCGCCCTCCACGCCAGCGGCGAGTCGGCCCGCTTCATCATCCAGGACCTGACCTTGCCCTACGCCAAGGCT
GAAGAGTTTATCCACTACACCACCCGCCAGTTTGCCATTTGGCCTCTCTGGCTGTGCCCCCTCAAGCAGACGCCG
CCGCCCACCTTTCACCCTTTTACTGGAGAGACGGATCCGGCCTCGGCCAAGCCCAGCGACATGCTCAACGTTGGC
CTCTGGGGCTGGGGGCCCGACGACCACGAGACCTTTATTGCCAAGAACCGCGCGCTCGAGGACGAGCTGGTGCGC
CTGGGCGGCCGCAAAATCCTCTACGCCCACACCTACTACACCCAAGACGAGTTTTGGCGCGTCTACAACCAGCAC
TCGGACACTAGGGCCTGGTACGAGGCGCTGCGGGAAAAGTACCACGCCACCACGCTGCCCACTGTTTACGAAAAG
GTGCGCATCGACATTGACGCTGCCCGCCGTGACTGCGCCAAGTGGCGCGCCTCGTTTACGGGCAGGCGGCCCATT
CCCGGCCTGTACGGGGTATACAAGAGCATCCAGAGCGGCGACTATGGCCTCCACCGCAATGCCGGGTGGAAGTTT
AAGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail