Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4796
Gene name
LocationContig_33:130159..132527
Strand+
Gene length (bp)2368
Transcript length (bp)2181
Coding sequence length (bp)2181
Protein length (aa) 727

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 2.0E+00 318 338
PF13516 LRR_6 Leucine Rich repeat 5.7E-02 370 390
PF12937 F-box-like F-box-like 9.7E-13 65 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 28 549 0.0E+00
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 31 590 1.0E-102
sp|O74783|POF2_SCHPO SCF E3 ubiquitin ligase complex F-box protein pof2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof2 PE=1 SV=1 66 544 6.0E-61
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 66 438 8.0E-34
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 66 438 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 28 549 0.0E+00
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 31 590 1.0E-102
sp|O74783|POF2_SCHPO SCF E3 ubiquitin ligase complex F-box protein pof2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof2 PE=1 SV=1 66 544 6.0E-61
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 66 438 8.0E-34
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 66 438 1.0E-33
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 66 438 1.0E-33
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 66 438 2.0E-32
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 61 438 8.0E-31
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 61 438 1.0E-30
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 62 416 1.0E-30
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 66 454 2.0E-30
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 62 416 1.0E-29
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 67 450 1.0E-29
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 61 446 7.0E-28
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 196 442 8.0E-28
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 196 442 9.0E-28
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 64 417 3.0E-27
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 64 417 3.0E-27
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 179 500 9.0E-26
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 179 500 1.0E-25
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 179 500 1.0E-25
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 179 500 4.0E-25
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 144 507 9.0E-25
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 158 500 2.0E-24
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 161 438 2.0E-24
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 161 438 5.0E-24
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 161 438 5.0E-24
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 56 505 1.0E-23
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 33 410 4.0E-21
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 64 505 6.0E-21
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 238 500 8.0E-21
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 238 500 8.0E-21
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 238 500 1.0E-20
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 63 504 7.0E-20
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 134 364 1.0E-19
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 134 364 1.0E-19
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 134 364 1.0E-19
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 160 499 1.0E-19
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 66 276 5.0E-19
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 142 468 8.0E-18
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 131 372 1.0E-17
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 134 356 1.0E-17
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 158 446 3.0E-17
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 238 494 1.0E-16
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 172 372 1.0E-16
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 213 494 4.0E-16
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 146 357 5.0E-16
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 179 398 1.0E-15
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 158 472 2.0E-15
sp|A2RT62|FXL16_MOUSE F-box/LRR-repeat protein 16 OS=Mus musculus GN=Fbxl16 PE=1 SV=1 61 436 4.0E-15
sp|Q5MJ12|FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus GN=Fbxl16 PE=2 SV=1 61 441 4.0E-15
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 158 442 6.0E-15
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 130 422 6.0E-15
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 188 547 7.0E-15
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 213 417 2.0E-14
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 120 371 2.0E-14
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 100 371 2.0E-14
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 130 367 4.0E-14
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 161 366 6.0E-14
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 130 367 7.0E-14
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 130 367 7.0E-14
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 161 371 8.0E-14
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 156 392 1.0E-13
sp|Q0VD31|FBXL4_BOVIN F-box/LRR-repeat protein 4 OS=Bos taurus GN=FBXL4 PE=2 SV=1 138 422 1.0E-13
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 232 512 3.0E-13
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 185 526 3.0E-13
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 283 502 4.0E-13
sp|Q5U201|AMN1_RAT Protein AMN1 homolog OS=Rattus norvegicus GN=Amn1 PE=2 SV=2 322 505 4.0E-13
sp|Q8BH70|FBXL4_MOUSE F-box/LRR-repeat protein 4 OS=Mus musculus GN=Fbxl4 PE=1 SV=1 138 422 5.0E-13
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 197 413 8.0E-13
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 109 284 9.0E-13
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 185 511 1.0E-12
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 185 511 1.0E-12
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 172 388 1.0E-12
sp|Q9UKA2|FBXL4_HUMAN F-box/LRR-repeat protein 4 OS=Homo sapiens GN=FBXL4 PE=1 SV=2 138 422 2.0E-12
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 164 443 3.0E-12
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 206 416 3.0E-12
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 100 371 3.0E-12
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 213 416 3.0E-12
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 100 371 3.0E-12
sp|Q5U201|AMN1_RAT Protein AMN1 homolog OS=Rattus norvegicus GN=Amn1 PE=2 SV=2 161 367 4.0E-12
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 135 441 5.0E-12
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 161 503 5.0E-12
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 109 284 5.0E-12
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 197 435 7.0E-12
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 164 366 1.0E-11
sp|Q8IY45|AMN1_HUMAN Protein AMN1 homolog OS=Homo sapiens GN=AMN1 PE=2 SV=4 147 367 1.0E-11
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 109 284 1.0E-11
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 238 505 2.0E-11
sp|Q9SRR1|FBL12_ARATH F-box/LRR-repeat protein 12 OS=Arabidopsis thaliana GN=FBL12 PE=2 SV=1 64 400 3.0E-11
sp|Q0P4D1|AMN1_DANRE Protein AMN1 homolog OS=Danio rerio GN=amn1 PE=2 SV=1 138 367 3.0E-11
sp|Q5R8X9|AMN1_PONAB Protein AMN1 homolog OS=Pongo abelii GN=AMN1 PE=2 SV=1 147 367 3.0E-11
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 197 416 4.0E-11
sp|O74999|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1 216 462 8.0E-11
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 161 366 9.0E-11
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 197 402 1.0E-10
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 197 402 1.0E-10
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 238 501 3.0E-10
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 157 305 3.0E-10
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 238 501 4.0E-10
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 197 402 5.0E-10
sp|Q32L08|AMN1_BOVIN Protein AMN1 homolog OS=Bos taurus GN=AMN1 PE=2 SV=2 315 503 5.0E-10
sp|Q9M096|FBL19_ARATH Putative F-box/LRR-repeat protein 19 OS=Arabidopsis thaliana GN=FBL19 PE=4 SV=1 62 245 6.0E-10
sp|Q32L08|AMN1_BOVIN Protein AMN1 homolog OS=Bos taurus GN=AMN1 PE=2 SV=2 160 367 7.0E-10
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 159 352 8.0E-10
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 283 470 8.0E-10
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 222 501 1.0E-09
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 158 288 1.0E-09
sp|Q8IY45|AMN1_HUMAN Protein AMN1 homolog OS=Homo sapiens GN=AMN1 PE=2 SV=4 315 503 1.0E-09
sp|Q3EC97|FBL14_ARATH F-box/LRR-repeat protein 14 OS=Arabidopsis thaliana GN=FBL14 PE=2 SV=1 174 514 1.0E-09
sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=2 SV=2 160 511 1.0E-09
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 156 338 2.0E-09
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 319 449 2.0E-09
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 283 451 2.0E-09
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 197 416 2.0E-09
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 133 247 2.0E-09
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 164 366 2.0E-09
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 158 247 3.0E-09
sp|Q8IY45|AMN1_HUMAN Protein AMN1 homolog OS=Homo sapiens GN=AMN1 PE=2 SV=4 192 425 3.0E-09
sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=2 SV=2 276 511 3.0E-09
sp|Q9SDA8|FBL10_ARATH F-box/LRR-repeat protein 10 OS=Arabidopsis thaliana GN=FBL10 PE=2 SV=1 146 462 3.0E-09
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 237 443 6.0E-09
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 275 443 6.0E-09
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 333 501 7.0E-09
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 108 284 7.0E-09
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 164 366 8.0E-09
sp|Q9ZWC6|ATB_ARATH F-box protein At-B OS=Arabidopsis thaliana GN=ATB PE=2 SV=1 196 446 9.0E-09
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 237 443 1.0E-08
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 158 361 1.0E-08
sp|Q9SDA8|FBL10_ARATH F-box/LRR-repeat protein 10 OS=Arabidopsis thaliana GN=FBL10 PE=2 SV=1 156 515 1.0E-08
sp|Q8VYT5|FB254_ARATH F-box protein At5g07670 OS=Arabidopsis thaliana GN=At5g07670 PE=2 SV=1 158 361 1.0E-08
sp|Q5R8X9|AMN1_PONAB Protein AMN1 homolog OS=Pongo abelii GN=AMN1 PE=2 SV=1 315 503 2.0E-08
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 333 501 3.0E-08
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 108 284 4.0E-08
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 122 315 4.0E-08
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 333 501 5.0E-08
sp|Q5R8X9|AMN1_PONAB Protein AMN1 homolog OS=Pongo abelii GN=AMN1 PE=2 SV=1 192 425 6.0E-08
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 333 501 9.0E-08
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 264 413 9.0E-08
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 333 501 1.0E-07
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 275 449 1.0E-07
sp|Q3EC97|FBL14_ARATH F-box/LRR-repeat protein 14 OS=Arabidopsis thaliana GN=FBL14 PE=2 SV=1 186 387 3.0E-07
sp|Q13309|SKP2_HUMAN S-phase kinase-associated protein 2 OS=Homo sapiens GN=SKP2 PE=1 SV=2 67 365 4.0E-07
sp|Q0P4D1|AMN1_DANRE Protein AMN1 homolog OS=Danio rerio GN=amn1 PE=2 SV=1 315 529 5.0E-07
sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=2 SV=2 164 535 6.0E-07
sp|Q8VYT5|FB254_ARATH F-box protein At5g07670 OS=Arabidopsis thaliana GN=At5g07670 PE=2 SV=1 172 461 6.0E-07
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 158 391 7.0E-07
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 284 451 7.0E-07
sp|Q8WV35|LRC29_HUMAN Leucine-rich repeat-containing protein 29 OS=Homo sapiens GN=LRRC29 PE=1 SV=1 319 422 7.0E-07
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 329 499 9.0E-07
sp|Q3EC97|FBL14_ARATH F-box/LRR-repeat protein 14 OS=Arabidopsis thaliana GN=FBL14 PE=2 SV=1 158 365 9.0E-07
sp|Q5MJ12|FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus GN=Fbxl16 PE=2 SV=1 135 391 1.0E-06
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 310 499 1.0E-06
sp|Q9S9X4|FBL8_ARATH Putative F-box/LRR-repeat protein 8 OS=Arabidopsis thaliana GN=FBL8 PE=3 SV=1 135 276 1.0E-06
sp|Q6CVS2|AMN1_KLULA Antagonist of mitotic exit network protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AMN1 PE=3 SV=1 58 318 1.0E-06
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 160 391 2.0E-06
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 164 276 2.0E-06
sp|Q32L08|AMN1_BOVIN Protein AMN1 homolog OS=Bos taurus GN=AMN1 PE=2 SV=2 192 425 3.0E-06
sp|Q9FDX1|SKIP1_ARATH F-box protein SKIP1 OS=Arabidopsis thaliana GN=SKIP1 PE=1 SV=1 164 323 4.0E-06
sp|Q8WV35|LRC29_HUMAN Leucine-rich repeat-containing protein 29 OS=Homo sapiens GN=LRRC29 PE=1 SV=1 172 265 6.0E-06
sp|Q6FRM1|AMN1_CANGA Antagonist of mitotic exit network protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AMN1 PE=3 SV=1 159 286 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4796
MTTLQPVALDESQDDSRSASSTASPGPADNEESDFFQGLNDSQSSIGVPNFQDMQVTESCGPPVSRLPNEILISV
FSRLNSPSDLYHCLLVSKRWARNAVDLLWHRPACSDWENHRRICQTLGQERPFFRYRDFIKRLNLATLADKVNDG
SVLPLAVCTRVERLTLTNCRGLTDSGLVALVENSPSLLALDISNDKNITERSIHAIAQNCKRLQGLNISGCDGIS
NESMIVLAQNCKFIKRLKLNECVQLRDDAIFAFAEHCPNILEIDLHQCHQIGNGPVTALLSKGRCLRELRLVSCE
LVDDNAFLNLPENQVYDHLRILDLTSCVRLTDAAIEKIIDAAPRLRNLVLAKCRNITDAAVRAIAKLGKNLHFVH
LGHCGQITDEGVKKLVNSCNRIRYVDLACCTNLTDESVRRLAVLPKLKRIGLVKCSSITDESVFALAEAAYRPRV
RRDANGMFFGTEFYGSPLERVHLSYCVNLTLKSILQLLNSCPRLTHLSLTGVPAFQREDFQSYCRIAPPEFTPHQ
RDVFCVFSGNMVSSFRDFLNASPRFQELRDSMPPRIGASRIRNTATRRSEALANNLAAEGEGYDDDAADEDNDFE
VLDGTEMAVDVNVQNQHMTPAIPPPPPPSFDQHVFAPLQHAHAGLGHYAYPSTMPLDPLAYQDFSGPGADNSAMV
SSGSSHALSNSAMISGPSLYHSTNAPGPNVAHSSGISSDARQQSDQSQHND*
Coding >OphauB2|4796
ATGACGACGCTACAACCCGTTGCCTTGGACGAATCCCAGGACGATTCTCGCTCGGCCTCGTCGACAGCATCACCT
GGTCCCGCCGACAACGAGGAGTCGGACTTTTTTCAGGGCCTCAACGACTCGCAGTCGTCGATTGGCGTTCCCAAC
TTCCAGGACATGCAAGTCACGGAATCTTGCGGCCCTCCGGTCAGCCGGCTGCCCAATGAAATTCTCATCAGTGTC
TTCTCAAGGTTGAACTCCCCGTCAGATTTGTATCACTGCCTGCTTGTCTCCAAACGCTGGGCCCGCAATGCCGTC
GATCTTCTGTGGCACAGACCAGCCTGCAGTGACTGGGAAAACCATCGCCGCATTTGTCAGACACTAGGCCAAGAA
CGACCCTTTTTCAGATATCGAGACTTCATTAAGCGGCTCAACCTGGCAACCTTGGCCGACAAGGTCAATGATGGC
AGCGTCTTGCCCCTGGCAGTCTGCACCAGAGTCGAGAGACTAACTTTGACAAACTGCCGAGGCCTCACAGACTCG
GGTCTTGTTGCCCTGGTTGAGAATAGCCCTTCGCTCCTGGCTCTGGATATCTCCAACGATAAGAACATTACTGAG
CGCTCCATCCATGCCATTGCACAGAACTGCAAGCGCTTACAGGGCCTTAACATCTCGGGTTGCGATGGCATCTCC
AACGAGAGTATGATTGTCTTGGCACAAAATTGCAAGTTTATCAAGCGGCTAAAACTCAATGAATGTGTTCAACTG
CGCGACGATGCCATATTTGCCTTTGCTGAACACTGCCCCAACATTCTCGAAATTGACCTGCATCAATGCCACCAA
ATAGGCAACGGGCCCGTGACTGCGCTCTTGTCAAAGGGACGTTGCTTACGCGAGCTGCGACTTGTCAGTTGCGAA
CTCGTCGACGACAATGCCTTCCTAAACCTACCCGAAAATCAAGTCTATGATCATTTGAGGATTCTTGACTTGACT
TCGTGTGTGAGACTCACCGACGCAGCCATCGAAAAGATTATTGATGCAGCCCCACGTCTGCGCAACCTTGTACTT
GCCAAGTGTCGAAACATTACAGACGCCGCCGTACGCGCCATTGCCAAGCTCGGCAAGAACCTGCACTTTGTGCAT
CTTGGTCACTGCGGCCAAATTACAGACGAAGGAGTAAAGAAGCTGGTTAATAGTTGCAACCGGATTCGCTACGTC
GACCTGGCCTGCTGTACAAACTTGACAGACGAGTCGGTCCGACGGCTTGCTGTTCTTCCAAAACTGAAGCGCATC
GGCCTCGTAAAGTGCAGCTCTATAACGGACGAGTCTGTCTTTGCGCTTGCCGAGGCCGCCTACCGACCTCGCGTC
CGACGAGATGCGAATGGCATGTTTTTTGGAACCGAGTTTTACGGCTCACCCCTGGAACGCGTTCACTTGAGCTAT
TGCGTCAATTTGACTCTCAAGAGTATCTTGCAGCTTCTCAATTCATGCCCTCGCCTGACGCACTTGAGCTTGACG
GGGGTGCCCGCGTTCCAGAGGGAAGACTTTCAATCATATTGTCGGATAGCACCTCCTGAGTTTACACCACATCAA
CGGGATGTGTTTTGTGTCTTCTCGGGCAACATGGTGTCCTCATTTCGAGACTTTCTCAATGCCTCCCCCAGATTC
CAGGAACTTCGAGATAGCATGCCTCCACGGATTGGCGCGAGTCGCATACGCAACACTGCTACGCGCCGATCTGAA
GCCTTGGCAAACAATCTTGCCGCTGAGGGTGAAGGCTACGATGATGACGCAGCTGATGAGGACAATGATTTCGAG
GTTTTGGATGGGACTGAGATGGCCGTCGATGTCAATGTACAAAATCAGCACATGACTCCCGCAATACCACCGCCT
CCACCACCGAGCTTTGACCAACATGTCTTTGCGCCCCTTCAGCACGCACACGCAGGACTGGGGCACTACGCCTAT
CCGTCGACGATGCCCTTGGATCCTCTTGCATATCAAGACTTTTCTGGTCCTGGAGCCGACAACTCCGCAATGGTG
TCTTCTGGTTCGAGCCATGCCCTTTCGAATTCGGCCATGATTTCGGGTCCCAGCTTATACCACTCTACTAATGCA
CCTGGCCCAAACGTGGCTCATTCCTCTGGTATCAGCAGTGACGCAAGACAGCAGTCAGACCAGAGCCAGCACAAC
GACTAG
Transcript >OphauB2|4796
ATGACGACGCTACAACCCGTTGCCTTGGACGAATCCCAGGACGATTCTCGCTCGGCCTCGTCGACAGCATCACCT
GGTCCCGCCGACAACGAGGAGTCGGACTTTTTTCAGGGCCTCAACGACTCGCAGTCGTCGATTGGCGTTCCCAAC
TTCCAGGACATGCAAGTCACGGAATCTTGCGGCCCTCCGGTCAGCCGGCTGCCCAATGAAATTCTCATCAGTGTC
TTCTCAAGGTTGAACTCCCCGTCAGATTTGTATCACTGCCTGCTTGTCTCCAAACGCTGGGCCCGCAATGCCGTC
GATCTTCTGTGGCACAGACCAGCCTGCAGTGACTGGGAAAACCATCGCCGCATTTGTCAGACACTAGGCCAAGAA
CGACCCTTTTTCAGATATCGAGACTTCATTAAGCGGCTCAACCTGGCAACCTTGGCCGACAAGGTCAATGATGGC
AGCGTCTTGCCCCTGGCAGTCTGCACCAGAGTCGAGAGACTAACTTTGACAAACTGCCGAGGCCTCACAGACTCG
GGTCTTGTTGCCCTGGTTGAGAATAGCCCTTCGCTCCTGGCTCTGGATATCTCCAACGATAAGAACATTACTGAG
CGCTCCATCCATGCCATTGCACAGAACTGCAAGCGCTTACAGGGCCTTAACATCTCGGGTTGCGATGGCATCTCC
AACGAGAGTATGATTGTCTTGGCACAAAATTGCAAGTTTATCAAGCGGCTAAAACTCAATGAATGTGTTCAACTG
CGCGACGATGCCATATTTGCCTTTGCTGAACACTGCCCCAACATTCTCGAAATTGACCTGCATCAATGCCACCAA
ATAGGCAACGGGCCCGTGACTGCGCTCTTGTCAAAGGGACGTTGCTTACGCGAGCTGCGACTTGTCAGTTGCGAA
CTCGTCGACGACAATGCCTTCCTAAACCTACCCGAAAATCAAGTCTATGATCATTTGAGGATTCTTGACTTGACT
TCGTGTGTGAGACTCACCGACGCAGCCATCGAAAAGATTATTGATGCAGCCCCACGTCTGCGCAACCTTGTACTT
GCCAAGTGTCGAAACATTACAGACGCCGCCGTACGCGCCATTGCCAAGCTCGGCAAGAACCTGCACTTTGTGCAT
CTTGGTCACTGCGGCCAAATTACAGACGAAGGAGTAAAGAAGCTGGTTAATAGTTGCAACCGGATTCGCTACGTC
GACCTGGCCTGCTGTACAAACTTGACAGACGAGTCGGTCCGACGGCTTGCTGTTCTTCCAAAACTGAAGCGCATC
GGCCTCGTAAAGTGCAGCTCTATAACGGACGAGTCTGTCTTTGCGCTTGCCGAGGCCGCCTACCGACCTCGCGTC
CGACGAGATGCGAATGGCATGTTTTTTGGAACCGAGTTTTACGGCTCACCCCTGGAACGCGTTCACTTGAGCTAT
TGCGTCAATTTGACTCTCAAGAGTATCTTGCAGCTTCTCAATTCATGCCCTCGCCTGACGCACTTGAGCTTGACG
GGGGTGCCCGCGTTCCAGAGGGAAGACTTTCAATCATATTGTCGGATAGCACCTCCTGAGTTTACACCACATCAA
CGGGATGTGTTTTGTGTCTTCTCGGGCAACATGGTGTCCTCATTTCGAGACTTTCTCAATGCCTCCCCCAGATTC
CAGGAACTTCGAGATAGCATGCCTCCACGGATTGGCGCGAGTCGCATACGCAACACTGCTACGCGCCGATCTGAA
GCCTTGGCAAACAATCTTGCCGCTGAGGGTGAAGGCTACGATGATGACGCAGCTGATGAGGACAATGATTTCGAG
GTTTTGGATGGGACTGAGATGGCCGTCGATGTCAATGTACAAAATCAGCACATGACTCCCGCAATACCACCGCCT
CCACCACCGAGCTTTGACCAACATGTCTTTGCGCCCCTTCAGCACGCACACGCAGGACTGGGGCACTACGCCTAT
CCGTCGACGATGCCCTTGGATCCTCTTGCATATCAAGACTTTTCTGGTCCTGGAGCCGACAACTCCGCAATGGTG
TCTTCTGGTTCGAGCCATGCCCTTTCGAATTCGGCCATGATTTCGGGTCCCAGCTTATACCACTCTACTAATGCA
CCTGGCCCAAACGTGGCTCATTCCTCTGGTATCAGCAGTGACGCAAGACAGCAGTCAGACCAGAGCCAGCACAAC
GACTAG
Gene >OphauB2|4796
ATGACGACGCTACAACCCGTTGCCTTGGACGAATCCCAGGACGATTCTCGCTCGGCCTCGTCGACAGCATCACCT
GGTCCCGCCGACAACGAGGAGTCGGACTTTTTTCAGGGCCTCAACGACTCGCAGTCGTCGATTGGCGTTCCCAAC
TTCCAGGACATGCAAGTCACGGAATCTTGCGGCCCTCCGGTCAGCCGGCTGCCCAATGAAATTCTCATCAGTGTC
TTCTCAAGGTTGAACTCCCCGTCAGATTTGTATCACTGCCTGCTTGTCTCCAAACGCTGGGCCCGCAATGCCGTC
GATCTTCTGTGGCACAGACCAGCCTGCAGTGACTGGGAAAACCATCGCCGCATTTGTCAGACACTAGGCCAAGAA
CGACCCTTTTTCAGATATCGAGACTTCATTAAGCGGCTCAACCTGGCAACCTTGGCCGACAAGGTCAATGATGGC
AGCGTCTTGCCCCTGGCAGTCTGCACCAGAGTCGAGAGACTAACTTTGACAAACTGCCGAGGCCTCACAGACTCG
GGTCTTGTTGCCCTGGTTGAGAATAGCCCTTCGCTCCTGGCTCTGGATATCTCCAACGATAAGAACATTACTGAG
CGCTCCATCCATGCCATTGCACAGAACTGCAAGCGCTTACAGGGCCTTAACATCTCGGGTTGCGATGGCATCTCC
AACGAGAGTATGATTGTCTTGGCACAAAATTGCAAGTTTATCAAGCGGGTATGATTTAAGGCTCGCTACTTTTGT
CCTGACGCCCTCTCTGGCCTCGTGCTAACTAGCTGCACCTGCAGCTAAAACTCAATGAATGTGTTCAACTGCGCG
ACGATGCCATATTTGCCTTTGCTGAACACTGCCCCAACATTCTCGAAATTGACCTGCATCAATGCCACCAAATAG
GCAACGGGCCCGTGACTGCGCTCTTGTCAAAGGGACGTTGCTTACGCGAGCTGCGACTTGTCAGTTGCGAACTCG
TCGACGACAATGCCTTCCTAAACCTACCCGAAAATCAAGTCTATGATCATTTGAGGATTCTTGACTTGACTTCGT
GTGTGAGACTCACCGACGCAGCCATCGAAAAGATTATTGATGCAGCCCCACGTCTGCGCAACCTTGTACTTGCCA
AGTGTCGAAACATTACAGACGCCGCCGTACGCGCCATTGCCAAGCTCGGCAAGAACCTGCACTTTGTGCATCTTG
GTCACTGCGGCCAAATTACAGACGAAGGAGTAAAGAAGCTGGTTAATAGTTGCAACCGGATTCGCTACGTCGACC
TGGCCTGCTGTACAAACTTGACAGACGAGTCGGTCCGACGGCTTGCTGTTCTTCCAAAACTGAAGCGCATCGGCC
TCGTAAAGTGCAGCTCTATAACGGACGAGTCTGTCTTTGCGCTTGCCGAGGCCGCCTACCGACCTCGCGTCCGAC
GAGATGCGAATGGCATGTTTTTTGGAACCGAGTTTTACGGCTCACCCCTGGAACGCGTTCACTTGAGCTATTGCG
TCAATTTGACTCTCAAGGTGGGCTGAATTGGAGCCAACACGCCTTGTGCTTGCTGCTAACACTAGCCCTCAGAGT
ATCTTGCAGCTTCTCAATTCATGCCCTCGCCTGACGCACTTGAGCTTGACGGGGGTGCCCGCGTTCCAGAGGGAA
GACTTTCAATCATATTGTCGGATAGCACCTCCTGGTAAGGCTTTGCCTTGTTGCTTATGCTTATTGCGCGAGCTA
TGCCTCTAATGATGACATAGAGTTTACACCACATCAACGGGATGTGTTTTGTGTCTTCTCGGGCAACATGGTGTC
CTCATTTCGAGACTTTCTCAATGCCTCCCCCAGATTCCAGGAACTTCGAGATAGCATGCCTCCACGGATTGGCGC
GAGTCGCATACGCAACACTGCTACGCGCCGATCTGAAGCCTTGGCAAACAATCTTGCCGCTGAGGGTGAAGGCTA
CGATGATGACGCAGCTGATGAGGACAATGATTTCGAGGTTTTGGATGGGACTGAGATGGCCGTCGATGTCAATGT
ACAAAATCAGCACATGACTCCCGCAATACCACCGCCTCCACCACCGAGCTTTGACCAACATGTCTTTGCGCCCCT
TCAGCACGCACACGCAGGACTGGGGCACTACGCCTATCCGTCGACGATGCCCTTGGATCCTCTTGCATATCAAGA
CTTTTCTGGTCCTGGAGCCGACAACTCCGCAATGGTGTCTTCTGGTTCGAGCCATGCCCTTTCGAATTCGGCCAT
GATTTCGGGTCCCAGCTTATACCACTCTACTAATGCACCTGGCCCAAACGTGGCTCATTCCTCTGGTATCAGCAG
TGACGCAAGACAGCAGTCAGACCAGAGCCAGCACAACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail