Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4795
Gene name
LocationContig_33:126715..129241
Strand+
Gene length (bp)2526
Transcript length (bp)2262
Coding sequence length (bp)2262
Protein length (aa) 754

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02065 Melibiase Melibiase 4.3E-151 311 662
PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain 3.9E-78 89 306
PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain 1.6E-20 675 750

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 36 752 0.0E+00
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 37 752 0.0E+00
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 37 752 0.0E+00
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 35 752 0.0E+00
sp|Q0CVH2|AGALC_ASPTN Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglC PE=3 SV=1 37 753 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 36 752 0.0E+00
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 37 752 0.0E+00
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 37 752 0.0E+00
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 35 752 0.0E+00
sp|Q0CVH2|AGALC_ASPTN Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglC PE=3 SV=1 37 753 0.0E+00
sp|Q5AU92|AGALC_EMENI Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglC PE=1 SV=1 37 752 0.0E+00
sp|Q0CEF5|AGALG_ASPTN Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglG PE=3 SV=1 33 752 0.0E+00
sp|Q5ARP5|AGALG_EMENI Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglG PE=2 SV=1 35 752 0.0E+00
sp|P43467|AGAL1_PEDPE Alpha-galactosidase 1 OS=Pediococcus pentosaceus GN=agaR PE=3 SV=1 37 736 4.0E-157
sp|P27756|AGAL_STRMU Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=aga PE=3 SV=3 96 746 5.0E-138
sp|P43469|AGAL2_PEDPE Alpha-galactosidase 2 OS=Pediococcus pentosaceus GN=agaS PE=3 SV=1 98 750 2.0E-114
sp|P16551|RAFA_ECOLX Alpha-galactosidase OS=Escherichia coli GN=rafA PE=1 SV=1 213 719 4.0E-83
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4795
MVRYSRCYYAQWLPDWDRLQSVKGVWCNDGQDLPEPIIVDGSSFALNGARVSYRFHVDNSSGDLISDHFGASVDG
DSIEAELGPIHGWVGVIGRVRREFPDQGSGDFRTPAIRIRQSQGYAVSRFRYQSHQVTKGKPSLQGLPSTFGTDD
QVSTLTIHMWDKYSSVAANLSYSVFPEYDAIVRSTVVTNKGNASITIEKLASLNVDLPHGDYDMLQLRGDWAREG
MRVRRKVDFGSQGFCSNAGYSSHFHNPFLSLLSPSTTETHGEAWGFSLIYTGSFCVEVEKGSQDLTRAMMGLNPS
QLSWSLGPGESFVSPEAVAVFSDEGVGAMSRKLHRLYRQHLMKSKFALQTRPVLLNSWEGLHFDYNATSILSLAH
ESASLGVKLFVLDDGWFGVKHPRVDDRSGLGDWQVNPEKFPEGLEPLVQTITALDTGDSASSSTLQFGLWFEPEM
VNPNSTLYENHPDWVLHAGDYPRTETRHQLVLNVALPEVQEFIIESVSRILNGSNISYVKWDNNRGIHETPSPST
DHEYMLGLYRVFETLTQRFPHVLWEGCASGGGRFDAGVLQYFPQIWTSDDTDGLERLAIQFGTSLAYPPSVMGAH
VSAVPNEQTGRTTPLEFRAHVAMMGGSFGFELNPSDMAAADRARVPELIALAEKVGPIVVTGDMWRLGLPEETNW
PAALFVSHDGRQAVLFYFQLRANINKSMPLLRLQGLDAKAQYQVDGRQVVSGATLMNKGVWYRFEGDYGSRVVML
EKL*
Coding >OphauB2|4795
ATGGTCCGTTACAGCCGATGCTACTATGCCCAATGGCTCCCGGATTGGGACAGGTTACAAAGCGTCAAGGGCGTT
TGGTGTAACGACGGTCAAGACTTGCCAGAGCCCATCATTGTTGACGGATCCTCCTTTGCCCTTAATGGCGCCCGC
GTCTCGTACCGATTTCACGTTGACAATAGCTCGGGAGATCTCATTTCTGACCACTTTGGAGCATCCGTCGATGGA
GACAGTATCGAGGCTGAGCTTGGCCCCATCCATGGCTGGGTGGGCGTGATTGGCAGAGTCAGGCGTGAATTCCCA
GACCAAGGCAGTGGCGACTTTCGAACTCCAGCGATTCGCATACGTCAGTCCCAAGGTTATGCTGTCAGTAGATTC
CGGTACCAGTCTCATCAGGTCACCAAGGGAAAGCCCTCGCTTCAGGGCTTGCCCTCAACATTTGGTACTGATGAC
CAGGTTTCGACCCTCACTATACATATGTGGGACAAATATAGCTCTGTAGCGGCCAATCTGTCCTACTCTGTTTTC
CCAGAGTACGATGCTATTGTGCGTAGCACCGTCGTCACGAATAAAGGCAACGCAAGCATTACCATTGAAAAGCTT
GCTAGTCTCAACGTCGATCTGCCACATGGAGACTACGACATGCTCCAGCTCAGGGGAGACTGGGCTCGAGAAGGC
ATGAGAGTCCGTCGCAAGGTTGACTTTGGAAGCCAGGGCTTTTGCAGCAATGCCGGATACTCATCTCACTTCCAC
AACCCCTTTCTCTCACTTCTCTCGCCATCAACAACCGAGACGCACGGCGAGGCCTGGGGCTTCTCTCTTATATAC
ACTGGCTCATTCTGTGTCGAGGTTGAGAAGGGATCCCAGGATCTGACCCGAGCCATGATGGGCCTTAACCCATCG
CAGCTTTCATGGTCCCTTGGGCCTGGAGAGAGCTTCGTCTCTCCGGAAGCAGTGGCTGTCTTCTCTGATGAAGGG
GTCGGAGCCATGTCACGAAAGCTGCACCGGCTTTACAGGCAACATCTCATGAAGAGCAAGTTTGCACTACAGACT
CGGCCAGTGCTGCTCAACAGCTGGGAGGGACTGCACTTTGACTATAATGCAACAAGCATTCTCAGCCTAGCCCAT
GAGTCGGCCAGCCTAGGGGTCAAGCTGTTCGTTCTCGATGACGGGTGGTTTGGTGTCAAGCATCCACGAGTTGAT
GATCGATCAGGCTTGGGGGACTGGCAAGTGAATCCCGAAAAGTTCCCAGAAGGCCTCGAACCCCTAGTCCAGACG
ATTACGGCACTCGACACTGGTGACTCGGCATCGTCTTCTACCTTGCAATTCGGTCTATGGTTTGAGCCCGAAATG
GTGAATCCCAATTCGACCTTGTACGAGAACCACCCAGATTGGGTGCTGCATGCGGGAGACTATCCCCGCACAGAG
ACACGCCATCAGCTGGTGCTTAATGTCGCGCTGCCAGAGGTGCAGGAATTTATCATCGAGTCAGTATCACGTATC
CTCAATGGATCAAACATCAGCTATGTCAAATGGGACAACAATCGGGGCATTCACGAAACGCCCAGCCCGAGCACT
GATCATGAGTATATGCTGGGCTTATATCGCGTCTTTGAGACTCTGACACAGCGGTTCCCACATGTGCTGTGGGAG
GGCTGCGCATCCGGTGGCGGTAGGTTCGATGCGGGAGTGTTGCAGTACTTTCCACAGATTTGGACATCAGACGAC
ACAGACGGATTGGAACGCCTCGCTATCCAATTTGGCACCTCTCTAGCCTATCCGCCCTCGGTAATGGGGGCCCAC
GTGTCGGCAGTGCCAAATGAACAGACGGGACGGACCACGCCGCTCGAGTTTCGAGCACATGTGGCCATGATGGGA
GGATCGTTTGGGTTCGAGCTCAACCCCAGCGACATGGCGGCAGCAGACAGGGCCAGGGTCCCAGAGCTGATTGCG
CTGGCGGAAAAGGTCGGCCCCATTGTGGTCACGGGCGACATGTGGCGGCTTGGGCTGCCCGAGGAGACCAACTGG
CCAGCGGCGCTCTTTGTATCGCACGACGGACGCCAGGCTGTTCTCTTCTACTTCCAGCTGCGGGCAAACATCAAC
AAGTCGATGCCACTGCTTCGACTCCAGGGACTCGACGCCAAGGCCCAGTACCAAGTCGATGGGCGGCAAGTGGTG
TCGGGAGCGACGCTGATGAACAAGGGCGTGTGGTACAGGTTTGAAGGCGACTACGGCAGCAGAGTGGTCATGCTA
GAGAAGCTCTGA
Transcript >OphauB2|4795
ATGGTCCGTTACAGCCGATGCTACTATGCCCAATGGCTCCCGGATTGGGACAGGTTACAAAGCGTCAAGGGCGTT
TGGTGTAACGACGGTCAAGACTTGCCAGAGCCCATCATTGTTGACGGATCCTCCTTTGCCCTTAATGGCGCCCGC
GTCTCGTACCGATTTCACGTTGACAATAGCTCGGGAGATCTCATTTCTGACCACTTTGGAGCATCCGTCGATGGA
GACAGTATCGAGGCTGAGCTTGGCCCCATCCATGGCTGGGTGGGCGTGATTGGCAGAGTCAGGCGTGAATTCCCA
GACCAAGGCAGTGGCGACTTTCGAACTCCAGCGATTCGCATACGTCAGTCCCAAGGTTATGCTGTCAGTAGATTC
CGGTACCAGTCTCATCAGGTCACCAAGGGAAAGCCCTCGCTTCAGGGCTTGCCCTCAACATTTGGTACTGATGAC
CAGGTTTCGACCCTCACTATACATATGTGGGACAAATATAGCTCTGTAGCGGCCAATCTGTCCTACTCTGTTTTC
CCAGAGTACGATGCTATTGTGCGTAGCACCGTCGTCACGAATAAAGGCAACGCAAGCATTACCATTGAAAAGCTT
GCTAGTCTCAACGTCGATCTGCCACATGGAGACTACGACATGCTCCAGCTCAGGGGAGACTGGGCTCGAGAAGGC
ATGAGAGTCCGTCGCAAGGTTGACTTTGGAAGCCAGGGCTTTTGCAGCAATGCCGGATACTCATCTCACTTCCAC
AACCCCTTTCTCTCACTTCTCTCGCCATCAACAACCGAGACGCACGGCGAGGCCTGGGGCTTCTCTCTTATATAC
ACTGGCTCATTCTGTGTCGAGGTTGAGAAGGGATCCCAGGATCTGACCCGAGCCATGATGGGCCTTAACCCATCG
CAGCTTTCATGGTCCCTTGGGCCTGGAGAGAGCTTCGTCTCTCCGGAAGCAGTGGCTGTCTTCTCTGATGAAGGG
GTCGGAGCCATGTCACGAAAGCTGCACCGGCTTTACAGGCAACATCTCATGAAGAGCAAGTTTGCACTACAGACT
CGGCCAGTGCTGCTCAACAGCTGGGAGGGACTGCACTTTGACTATAATGCAACAAGCATTCTCAGCCTAGCCCAT
GAGTCGGCCAGCCTAGGGGTCAAGCTGTTCGTTCTCGATGACGGGTGGTTTGGTGTCAAGCATCCACGAGTTGAT
GATCGATCAGGCTTGGGGGACTGGCAAGTGAATCCCGAAAAGTTCCCAGAAGGCCTCGAACCCCTAGTCCAGACG
ATTACGGCACTCGACACTGGTGACTCGGCATCGTCTTCTACCTTGCAATTCGGTCTATGGTTTGAGCCCGAAATG
GTGAATCCCAATTCGACCTTGTACGAGAACCACCCAGATTGGGTGCTGCATGCGGGAGACTATCCCCGCACAGAG
ACACGCCATCAGCTGGTGCTTAATGTCGCGCTGCCAGAGGTGCAGGAATTTATCATCGAGTCAGTATCACGTATC
CTCAATGGATCAAACATCAGCTATGTCAAATGGGACAACAATCGGGGCATTCACGAAACGCCCAGCCCGAGCACT
GATCATGAGTATATGCTGGGCTTATATCGCGTCTTTGAGACTCTGACACAGCGGTTCCCACATGTGCTGTGGGAG
GGCTGCGCATCCGGTGGCGGTAGGTTCGATGCGGGAGTGTTGCAGTACTTTCCACAGATTTGGACATCAGACGAC
ACAGACGGATTGGAACGCCTCGCTATCCAATTTGGCACCTCTCTAGCCTATCCGCCCTCGGTAATGGGGGCCCAC
GTGTCGGCAGTGCCAAATGAACAGACGGGACGGACCACGCCGCTCGAGTTTCGAGCACATGTGGCCATGATGGGA
GGATCGTTTGGGTTCGAGCTCAACCCCAGCGACATGGCGGCAGCAGACAGGGCCAGGGTCCCAGAGCTGATTGCG
CTGGCGGAAAAGGTCGGCCCCATTGTGGTCACGGGCGACATGTGGCGGCTTGGGCTGCCCGAGGAGACCAACTGG
CCAGCGGCGCTCTTTGTATCGCACGACGGACGCCAGGCTGTTCTCTTCTACTTCCAGCTGCGGGCAAACATCAAC
AAGTCGATGCCACTGCTTCGACTCCAGGGACTCGACGCCAAGGCCCAGTACCAAGTCGATGGGCGGCAAGTGGTG
TCGGGAGCGACGCTGATGAACAAGGGCGTGTGGTACAGGTTTGAAGGCGACTACGGCAGCAGAGTGGTCATGCTA
GAGAAGCTCTGA
Gene >OphauB2|4795
ATGGTCCGTTACAGCCGATGCTACTATGCCCAATGGCTCCCGGATTGGGACAGGTTACAGTAAGTAAAAATCCCC
CACAGTCTGGCGGTTGATAGAGCAAGGGCGCTCCAATTGTCTCGCTGGTCAAGGTTTCCTCTAGACTGACAAGCT
ACCAGAAGCGTCAAGGGTGAAAGGGCATGGCCTCGTCTTTTTGGCAGCTAGCTGTGGTGGTATTGGTGTTGGGTC
TGACAGGCGTTTGGTGTAACGACGGTCAAGACTTGCCAGAGCGTAGGTGGTAAGATGCAGCACGCAAGCAACTGC
TGACATCAAATGCAGCCATCATTGTTGACGGATCCTCCTTTGCCCTTAATGGCGCCCGCGTCTCGTACCGATTTC
ACGTTGACAATAGCTCGGGAGATCTCATTTCTGACCACTTTGGAGCATCCGTCGATGGAGACAGTATCGAGGCTG
AGCTTGGCCCCATCCATGGCTGGGTGGGCGTGATTGGCAGAGTCAGGCGTGAATTCCCAGACCAAGGCAGTGGCG
ACTTTCGAACTCCAGCGATTCGCATACGTCAGTCCCAAGGTTATGCTGTCAGTAGATTCCGGTACCAGTCTCATC
AGGTCACCAAGGGAAAGCCCTCGCTTCAGGGCTTGCCCTCAACATTTGGTACTGATGACCAGGTTTCGACCCTCA
CTATACATATGTGGGACAAATATAGCTCTGTAGCGGCCAATCTGTCCTACTCTGTTTTCCCAGAGTACGATGCTA
TTGTGCGTAGCACCGTCGTCACGAATAAAGGCAACGCAAGCATTACCATTGAAAAGCTTGCTAGTCTCAACGTCG
ATCTGCCACATGGAGACTACGACATGCTCCAGCTCAGGGGAGACTGGGCTCGAGAAGGCATGAGAGTCCGTCGCA
AGGTTGACTTTGGAAGCCAGGGGTGAGCTAGTCTGGCCGCGGCCTCAGCCAAGCGCTTTTGGCTTACACTGTAAC
AGCTTTTGCAGCAATGCCGGATACTCATCTCACTTCCACAACCCCTTTCTCTCACTTCTCTCGCCATCAACAACC
GAGACGCACGGCGAGGCCTGGGGCTTCTCTCTTATATACACTGGCTCATTCTGTGTCGAGGTTGAGAAGGGATCC
CAGGATCTGACCCGAGCCATGATGGGCCTTAACCCATCGCAGCTTTCATGGTCCCTTGGGCCTGGAGAGAGCTTC
GTCTCTCCGGAAGCAGTGGCTGTCTTCTCTGATGAAGGGGTCGGAGCCATGTCACGAAAGCTGCACCGGCTTTAC
AGGCAACATCTCATGAAGAGCAAGTTTGCACTACAGACTCGGCCAGTGCTGCTCAACAGCTGGGAGGGACTGCAC
TTTGACTATAATGCAACAAGCATTCTCAGCCTAGCCCATGAGTCGGCCAGCCTAGGGGTCAAGCTGTTCGTTCTC
GATGACGGGTGGTTTGGTGTCAAGCATCCACGAGTTGATGATCGATCAGGCTTGGGGGACTGGCAAGTGAATCCC
GAAAAGTTCCCAGAAGGCCTCGAACCCCTAGTCCAGACGATTACGGCACTCGACACTGGTGACTCGGCATCGTCT
TCTACCTTGCAATTCGGTCTATGGTTTGAGCCCGAAATGGTGAATCCCAATTCGACCTTGTACGAGAACCACCCA
GATTGGGTGCTGCATGCGGGAGACTATCCCCGCACAGAGACACGCCATCAGCTGGTGCTTAATGTCGCGCTGCCA
GAGGTGCAGGAATTTATCATCGAGTCAGTATCACGTATCCTCAATGGATCAAACATCAGCTATGTCAAATGGGAC
AACAATCGGGGCATTCACGAAACGCCCAGCCCGAGCACTGATCATGAGTATATGCTGGGCTTATATCGCGTCTTT
GAGACTCTGACACAGCGGTTCCCACATGTGCTGTGGGAGGGCTGCGCATCCGGTGGCGGTAGGTTCGATGCGGGA
GTGTTGCAGTACTTTCCACAGATTTGGACATCAGACGACACAGACGGATTGGAACGCCTCGCTATCCAATTTGGC
ACCTCTCTAGCCTATCCGCCCTCGGTAATGGGGGCCCACGTGTCGGCAGTGCCAAATGAACAGACGGGACGGACC
ACGCCGCTCGAGTTTCGAGCACATGTGGCCATGATGGGAGGATCGTTTGGGTTCGAGCTCAACCCCAGCGACATG
GCGGCAGCAGACAGGGCCAGGGTCCCAGAGCTGATTGCGCTGGCGGAAAAGGTCGGCCCCATTGTGGTCACGGGC
GACATGTGGCGGCTTGGGCTGCCCGAGGAGACCAACTGGCCAGCGGCGCTCTTTGTATCGCACGACGGACGCCAG
GCTGTTCTCTTCTACTTCCAGCTGCGGGCAAACATCAACAAGTCGATGCCACTGCTTCGACTCCAGGGACTCGAC
GCCAAGGCCCAGTACCAAGTCGATGGGCGGCAAGTGGTGTCGGGAGCGACGCTGATGAACAAGGGCGTGTGGTAC
AGGTTTGAAGGCGACTACGGCAGCAGAGTGGTCATGCTAGAGAAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail