Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4793
Gene name
LocationContig_33:124158..124699
Strand+
Gene length (bp)541
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 4.2E-21 17 79
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 1.5E-05 20 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55143|GLRX_RICCO Glutaredoxin OS=Ricinus communis PE=3 SV=1 4 104 2.0E-33
sp|Q6K953|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1 7 104 7.0E-32
sp|P55142|GRXC6_ORYSJ Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2 4 104 8.0E-32
sp|Q9ZR41|GLRX_SOLLC Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1 7 104 1.0E-31
sp|Q9FNE2|GRXC2_ARATH Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1 4 107 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55143|GLRX_RICCO Glutaredoxin OS=Ricinus communis PE=3 SV=1 4 104 2.0E-33
sp|Q6K953|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1 7 104 7.0E-32
sp|P55142|GRXC6_ORYSJ Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2 4 104 8.0E-32
sp|Q9ZR41|GLRX_SOLLC Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1 7 104 1.0E-31
sp|Q9FNE2|GRXC2_ARATH Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1 4 107 1.0E-30
sp|Q8L8T2|GRXC1_ARATH Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2 7 104 4.0E-29
sp|O81187|GLRX_VERFO Glutaredoxin OS=Vernicia fordii PE=3 SV=1 4 106 2.0E-27
sp|P17695|GLRX2_YEAST Glutaredoxin-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX2 PE=1 SV=3 3 99 2.0E-25
sp|O36032|GLRX1_SCHPO Glutaredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx1 PE=3 SV=1 6 98 1.0E-24
sp|Q8LFQ6|GRXC4_ARATH Glutaredoxin-C4 OS=Arabidopsis thaliana GN=GRXC4 PE=2 SV=2 8 108 1.0E-23
sp|B7ZFT1|GLRX1_RHIID Glutaredoxin-1 OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GRX1 PE=2 SV=3 1 98 2.0E-23
sp|Q0DAE4|GRXC8_ORYSJ Glutaredoxin-C8 OS=Oryza sativa subsp. japonica GN=GRXC8 PE=2 SV=2 2 98 4.0E-23
sp|Q9FVX1|GRXC3_ARATH Glutaredoxin-C3 OS=Arabidopsis thaliana GN=GRXC3 PE=2 SV=1 5 101 5.0E-23
sp|Q9UTI2|GLRX2_SCHPO Glutaredoxin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx2 PE=3 SV=1 8 100 9.0E-23
sp|Q923X4|GLRX2_MOUSE Glutaredoxin-2, mitochondrial OS=Mus musculus GN=Glrx2 PE=1 SV=1 7 100 2.0E-22
sp|Q6AXW1|GLRX2_RAT Glutaredoxin-2, mitochondrial OS=Rattus norvegicus GN=Glrx2 PE=2 SV=2 7 100 7.0E-22
sp|Q9NS18|GLRX2_HUMAN Glutaredoxin-2, mitochondrial OS=Homo sapiens GN=GLRX2 PE=1 SV=1 7 100 9.0E-22
sp|Q32L67|GLRX2_BOVIN Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLRX2 PE=2 SV=1 7 100 1.0E-21
sp|Q5RC53|GLRX2_PONAB Glutaredoxin-2, mitochondrial OS=Pongo abelii GN=GLRX2 PE=2 SV=1 7 100 3.0E-21
sp|Q54GP8|GLRX_DICDI Glutaredoxin OS=Dictyostelium discoideum GN=grxA PE=2 SV=1 7 104 6.0E-21
sp|Q8LBS4|GRS12_ARATH Monothiol glutaredoxin-S12, chloroplastic OS=Arabidopsis thaliana GN=GRXS12 PE=1 SV=2 8 107 2.0E-20
sp|Q8GWS0|GRXC5_ARATH Glutaredoxin-C5, chloroplastic OS=Arabidopsis thaliana GN=GRXC5 PE=1 SV=1 8 107 3.0E-20
sp|Q0J3L4|GRS10_ORYSJ Monothiol glutaredoxin-S10 OS=Oryza sativa subsp. japonica GN=GRXS10 PE=2 SV=2 8 100 7.0E-20
sp|Q99MD6|TRXR3_MOUSE Thioredoxin reductase 3 OS=Mus musculus GN=Txnrd3 PE=1 SV=3 11 103 2.0E-19
sp|Q86VQ6|TRXR3_HUMAN Thioredoxin reductase 3 OS=Homo sapiens GN=TXNRD3 PE=1 SV=4 11 100 2.0E-18
sp|P12309|GLRX1_PIG Glutaredoxin-1 OS=Sus scrofa GN=GLRX PE=1 SV=2 1 105 3.0E-18
sp|Q6H628|GRXS6_ORYSJ Monothiol glutaredoxin-S6 OS=Oryza sativa subsp. japonica GN=GRXS6 PE=2 SV=1 5 101 3.0E-18
sp|P12864|GLRX1_RABIT Glutaredoxin-1 OS=Oryctolagus cuniculus GN=GLRX PE=1 SV=1 12 105 5.0E-18
sp|Q9QUH0|GLRX1_MOUSE Glutaredoxin-1 OS=Mus musculus GN=Glrx PE=1 SV=3 12 105 2.0E-17
sp|P10575|GLRX1_BOVIN Glutaredoxin-1 OS=Bos taurus GN=GLRX PE=1 SV=3 1 105 6.0E-17
sp|P38068|GLRX7_YEAST Monothiol glutaredoxin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX7 PE=1 SV=1 3 99 6.0E-17
sp|P25373|GLRX1_YEAST Glutaredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX1 PE=1 SV=1 3 86 6.0E-17
sp|Q9ESH6|GLRX1_RAT Glutaredoxin-1 OS=Rattus norvegicus GN=Glrx PE=3 SV=3 12 105 1.0E-16
sp|P35754|GLRX1_HUMAN Glutaredoxin-1 OS=Homo sapiens GN=GLRX PE=1 SV=2 12 105 2.0E-16
sp|P68691|GLRX1_VACCP Glutaredoxin-1 OS=Vaccinia virus (strain L-IVP) PE=3 SV=1 8 106 2.0E-15
sp|Q80E01|GLRX1_CWPXG Glutaredoxin-1 OS=Cowpox virus (strain GRI-90 / Grishak) GN=R2L PE=3 SV=1 8 105 2.0E-15
sp|Q6RZN3|GLRX1_RABPU Glutaredoxin-1 OS=Rabbitpox virus (strain Utrecht) GN=RPXV058 PE=3 SV=1 8 106 2.0E-15
sp|Q76ZV3|GLRX1_VACCA Glutaredoxin-1 OS=Vaccinia virus (strain Ankara) GN=MVA061L PE=3 SV=1 8 106 2.0E-15
sp|P68690|GLRX1_VACCC Glutaredoxin-1 OS=Vaccinia virus (strain Copenhagen) GN=O2L PE=3 SV=1 8 106 2.0E-15
sp|Q77TL9|GLRX1_VACCT Glutaredoxin-1 OS=Vaccinia virus (strain Tian Tan) GN=TO2L PE=3 SV=1 8 106 2.0E-15
sp|P68692|GLRX1_VACCW Glutaredoxin-1 OS=Vaccinia virus (strain Western Reserve) GN=VACWR069 PE=1 SV=1 8 106 2.0E-15
sp|Q8QMY9|GLRX1_CWPXB Glutaredoxin-1 OS=Cowpox virus (strain Brighton Red) GN=CPXV079 PE=3 SV=1 8 105 2.0E-15
sp|Q775X4|GLRX1_CAMPS Glutaredoxin-1 OS=Camelpox virus (strain CMS) GN=CMP66L PE=3 SV=1 8 105 3.0E-15
sp|Q8V2V1|GLRX1_CAMPM Glutaredoxin-1 OS=Camelpox virus (strain M-96) GN=CMLV067 PE=3 SV=1 8 105 3.0E-15
sp|P32983|GLRX1_VAR67 Glutaredoxin-1 OS=Variola virus (isolate Human/India/Ind3/1967) GN=O2L PE=3 SV=1 8 106 1.0E-14
sp|Q8JLF5|GLRX1_ECTVM Glutaredoxin-1 OS=Ectromelia virus (strain Moscow) GN=EVM053 PE=1 SV=1 8 106 1.0E-14
sp|Q7G8Y5|GRXC1_ORYSJ Glutaredoxin-C1 OS=Oryza sativa subsp. japonica GN=GRXC1 PE=3 SV=1 7 104 1.0E-14
sp|P79764|GLRX1_CHICK Glutaredoxin-1 OS=Gallus gallus GN=GLRX PE=3 SV=1 8 104 2.0E-14
sp|Q0JG89|GRXC2_ORYSJ Putative glutaredoxin-C2 OS=Oryza sativa subsp. japonica GN=GRXC2 PE=3 SV=2 1 104 2.0E-14
sp|Q9LYC8|GRXS6_ARATH Monothiol glutaredoxin-S6 OS=Arabidopsis thaliana GN=GRXS6 PE=3 SV=1 8 104 3.0E-14
sp|Q9SA68|GRXS1_ARATH Monothiol glutaredoxin-S1 OS=Arabidopsis thaliana GN=GRXS1 PE=3 SV=1 7 104 3.0E-14
sp|Q19297|YZ73_CAEEL Uncharacterized monothiol glutaredoxin F10D7.3 OS=Caenorhabditis elegans GN=F10D7.3 PE=3 SV=2 17 104 3.0E-13
sp|Q16881|TRXR1_HUMAN Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens GN=TXNRD1 PE=1 SV=3 2 102 3.0E-13
sp|Q0IMV4|GRC14_ORYSJ Putative glutaredoxin-C14 OS=Oryza sativa subsp. japonica GN=GRXC14 PE=3 SV=2 7 104 1.0E-12
sp|Q12438|GLRX6_YEAST Monothiol glutaredoxin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX6 PE=1 SV=1 12 99 1.0E-12
sp|O82254|GRC12_ARATH Putative glutaredoxin-C12 OS=Arabidopsis thaliana GN=GRXC12 PE=3 SV=1 7 104 7.0E-12
sp|Q9HU55|GLRX_PSEAE Glutaredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=grx PE=3 SV=1 17 98 9.0E-12
sp|Q9LIF1|GRS10_ARATH Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana GN=GRXS10 PE=3 SV=1 8 104 1.0E-11
sp|P0C290|GRXS8_ORYSJ Monothiol glutaredoxin-S8 OS=Oryza sativa subsp. japonica GN=GRXS8 PE=3 SV=1 7 104 4.0E-11
sp|Q8L8Z8|GRXS2_ARATH Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1 8 104 5.0E-11
sp|Q9LYC6|GRC11_ARATH Glutaredoxin-C11 OS=Arabidopsis thaliana GN=GRXC11 PE=3 SV=1 7 104 5.0E-11
sp|O23419|GRXS4_ARATH Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1 7 104 5.0E-11
sp|O23421|GRXS3_ARATH Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1 8 104 6.0E-11
sp|Q2R073|GRC12_ORYSJ Putative glutaredoxin-C12 OS=Oryza sativa subsp. japonica GN=GRXC12 PE=3 SV=1 8 104 7.0E-11
sp|Q2R075|GRC11_ORYSJ Putative glutaredoxin-C11 OS=Oryza sativa subsp. japonica GN=GRXC11 PE=3 SV=1 8 104 8.0E-11
sp|O23420|GRXS5_ARATH Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1 8 104 1.0E-10
sp|O23417|GRXS8_ARATH Monothiol glutaredoxin-S8 OS=Arabidopsis thaliana GN=GRXS8 PE=3 SV=1 7 104 1.0E-10
sp|Q9JY15|GLRX_NEIMB Glutaredoxin OS=Neisseria meningitidis serogroup B (strain MC58) GN=grx PE=3 SV=1 17 98 3.0E-10
sp|Q9JVU9|GLRX_NEIMA Glutaredoxin OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=grx PE=3 SV=1 17 99 3.0E-10
sp|P0AC64|GLRX3_ECO57 Glutaredoxin-3 OS=Escherichia coli O157:H7 GN=grxC PE=3 SV=2 17 99 4.0E-10
sp|P0AC63|GLRX3_ECOL6 Glutaredoxin-3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=grxC PE=3 SV=2 17 99 4.0E-10
sp|Q2QP86|GRC15_ORYSJ Glutaredoxin-C15 OS=Oryza sativa subsp. japonica GN=GRXC15 PE=3 SV=1 7 104 4.0E-10
sp|P0AC62|GLRX3_ECOLI Glutaredoxin-3 OS=Escherichia coli (strain K12) GN=grxC PE=1 SV=2 17 99 4.0E-10
sp|Q6NLU2|GRXS7_ARATH Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2 7 104 5.0E-10
sp|Q0IRB0|GRC13_ORYSJ Glutaredoxin-C13 OS=Oryza sativa subsp. japonica GN=GRXC13 PE=3 SV=2 8 104 5.0E-10
sp|Q9Y7N3|GLRX3_SCHPO Monothiol glutaredoxin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx3 PE=3 SV=3 2 100 1.0E-09
sp|Q2R076|GRC10_ORYSJ Glutaredoxin-C10 OS=Oryza sativa subsp. japonica GN=GRXC10 PE=3 SV=1 7 104 3.0E-09
sp|Q9LYC5|GRC14_ARATH Glutaredoxin-C14 OS=Arabidopsis thaliana GN=GRXC14 PE=3 SV=1 7 99 3.0E-09
sp|Q8LF89|GRXC8_ARATH Glutaredoxin-C8 OS=Arabidopsis thaliana GN=GRXC8 PE=1 SV=2 2 104 4.0E-09
sp|Q8L9S3|GRXC6_ARATH Glutaredoxin-C6 OS=Arabidopsis thaliana GN=GRXC6 PE=2 SV=2 7 104 1.0E-08
sp|O82255|GRC13_ARATH Glutaredoxin-C13 OS=Arabidopsis thaliana GN=GRXC13 PE=3 SV=1 7 99 3.0E-08
sp|O04341|GRXS9_ARATH Monothiol glutaredoxin-S9 OS=Arabidopsis thaliana GN=GRXS9 PE=3 SV=1 7 99 5.0E-08
sp|Q92J02|GLRX1_RICCN Glutaredoxin-1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=grxC1 PE=3 SV=1 15 98 5.0E-08
sp|P73492|GLRX2_SYNY3 Probable glutaredoxin ssr2061 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ssr2061 PE=1 SV=1 17 98 9.0E-08
sp|Q6K609|GRXC3_ORYSJ Glutaredoxin-C3 OS=Oryza sativa subsp. japonica GN=GRXC3 PE=2 SV=1 25 104 1.0E-07
sp|Q9SGP6|GRXC9_ARATH Glutaredoxin-C9 OS=Arabidopsis thaliana GN=GRXC9 PE=1 SV=1 7 104 1.0E-07
sp|Q4UKL7|GLRX1_RICFE Glutaredoxin-1 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=grxC1 PE=3 SV=1 15 98 1.0E-07
sp|Q9ZDW1|GLRX1_RICPR Glutaredoxin-1 OS=Rickettsia prowazekii (strain Madrid E) GN=grxC1 PE=3 SV=1 15 98 2.0E-07
sp|Q1RHJ0|GLRX1_RICBR Glutaredoxin-1 OS=Rickettsia bellii (strain RML369-C) GN=grxC1 PE=3 SV=1 15 98 5.0E-07
sp|P44758|PRX5_HAEIN Hybrid peroxiredoxin hyPrx5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0572 PE=1 SV=1 9 87 6.0E-07
sp|Q68XG4|GLRX1_RICTY Glutaredoxin-1 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=grxC1 PE=3 SV=1 15 98 8.0E-07
sp|Q0DK35|GRXC7_ORYSJ Glutaredoxin-C7 OS=Oryza sativa subsp. japonica GN=GRXC7 PE=3 SV=1 3 104 8.0E-07
sp|Q9M9Y9|GRS11_ARATH Monothiol glutaredoxin-S11 OS=Arabidopsis thaliana GN=GRXS11 PE=3 SV=1 7 99 4.0E-06
sp|Q96305|GRXC7_ARATH Glutaredoxin-C7 OS=Arabidopsis thaliana GN=GRXC7 PE=1 SV=2 7 104 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006749 glutathione metabolic process Yes
GO:0005515 protein binding Yes
GO:0097573 glutathione oxidoreductase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0015035 protein-disulfide reductase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0015036 disulfide oxidoreductase activity No
GO:0006575 cellular modified amino acid metabolic process No
GO:0006518 peptide metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016491 oxidoreductase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4793
MAEASTKVQHFIDDNAVMVFSKSYCPYCEKTKKTLSELGAEYTTVELDKEDDGSELQDALEKITGQRTVPNVLIK
KKHIGGNSDIQELNKLGKLADLLKESGALKAQL*
Coding >OphauB2|4793
ATGGCCGAAGCAAGCACCAAAGTCCAGCACTTTATTGACGACAACGCCGTCATGGTGTTTTCGAAATCTTACTGT
CCTTACTGCGAAAAGACCAAGAAGACGCTCAGCGAGCTTGGCGCCGAGTACACTACTGTGGAGCTCGACAAGGAG
GACGACGGCAGCGAGCTGCAGGACGCCCTCGAGAAAATCACTGGCCAGCGCACCGTGCCCAATGTGCTCATCAAA
AAGAAGCACATTGGCGGCAACTCGGATATTCAAGAGCTCAACAAGCTTGGCAAGCTAGCTGACCTGCTCAAGGAG
TCGGGAGCGCTCAAGGCACAACTTTAA
Transcript >OphauB2|4793
ATGGCCGAAGCAAGCACCAAAGTCCAGCACTTTATTGACGACAACGCCGTCATGGTGTTTTCGAAATCTTACTGT
CCTTACTGCGAAAAGACCAAGAAGACGCTCAGCGAGCTTGGCGCCGAGTACACTACTGTGGAGCTCGACAAGGAG
GACGACGGCAGCGAGCTGCAGGACGCCCTCGAGAAAATCACTGGCCAGCGCACCGTGCCCAATGTGCTCATCAAA
AAGAAGCACATTGGCGGCAACTCGGATATTCAAGAGCTCAACAAGCTTGGCAAGCTAGCTGACCTGCTCAAGGAG
TCGGGAGCGCTCAAGGCACAACTTTAA
Gene >OphauB2|4793
ATGGCCGAAGCAAGCACCAAAGTCCAGCACTTTATTGACGACAACGCCGTCAGTATGTGGTTTCTTTCGATGGCT
CTCTCCACGCTTCAGGGGACTGGCGGCTGACTGCTTGTCCTAGTGGTGTTTTCGAAATCTTACTGTCCTTACTGC
GAAAAGACCAAGAAGACGCTCAGCGAGCTTGGCGCCGAGTACACTACTGTGGAGCTCGACAAGGAGGGTACGCTT
GTGTTGCTTTGCTCGACTTGATGGCGCTTGGCCTCGCTGACATGAAGCGCCTACCATAGACGACGGCAGCGAGCT
GCAGGACGCCCTCGAGAAAATCACTGGCCAGCGCACCGTGCCCAATGTGCTCATCAAAAAGAAGCACATTGGCGG
CAACTCGGATATTCAAGAGCTCAACAAGCTTGGCAAGCTAGCTGACCTGCTCAAGGAGTCGGGAGCGCTCAAGGC
GTAAGCGTTTCTCGTCTTTTTCCATGACGGAGGAAGAACCGCTGAGTCGCTGATGGCTTGTGGCTCGGCGGTACT
GCACAGACAACTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail