Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4790
Gene name
LocationContig_33:117969..118971
Strand-
Gene length (bp)1002
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00572 Ribosomal_L13 Ribosomal protein L13 3.2E-23 7 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P720|RL16_NEUCR 60S ribosomal protein L16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-46 PE=3 SV=1 1 202 1.0E-130
sp|P26784|RL16A_YEAST 60S ribosomal protein L16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL16A PE=1 SV=3 3 202 1.0E-99
sp|O42848|RL16A_SCHPO 60S ribosomal protein L16-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1602 PE=1 SV=1 1 202 6.0E-96
sp|O42991|RL16B_SCHPO 60S ribosomal protein L16-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1601 PE=1 SV=1 1 202 6.0E-96
sp|O43004|RL16C_SCHPO 60S ribosomal protein L16-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1603 PE=3 SV=1 1 202 5.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P720|RL16_NEUCR 60S ribosomal protein L16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-46 PE=3 SV=1 1 202 1.0E-130
sp|P26784|RL16A_YEAST 60S ribosomal protein L16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL16A PE=1 SV=3 3 202 1.0E-99
sp|O42848|RL16A_SCHPO 60S ribosomal protein L16-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1602 PE=1 SV=1 1 202 6.0E-96
sp|O42991|RL16B_SCHPO 60S ribosomal protein L16-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1601 PE=1 SV=1 1 202 6.0E-96
sp|O43004|RL16C_SCHPO 60S ribosomal protein L16-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1603 PE=3 SV=1 1 202 5.0E-93
sp|P26785|RL16B_YEAST 60S ribosomal protein L16-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL16B PE=1 SV=3 5 202 1.0E-92
sp|P93099|RL13A_CYAPA 60S ribosomal protein L13a OS=Cyanophora paradoxa PE=2 SV=1 4 175 1.0E-83
sp|Q3SZ90|RL13A_BOVIN 60S ribosomal protein L13a OS=Bos taurus GN=RPL13A PE=2 SV=3 7 202 2.0E-81
sp|P40429|RL13A_HUMAN 60S ribosomal protein L13a OS=Homo sapiens GN=RPL13A PE=1 SV=2 7 192 2.0E-81
sp|P19253|RL13A_MOUSE 60S ribosomal protein L13a OS=Mus musculus GN=Rpl13a PE=1 SV=4 7 190 6.0E-81
sp|Q4R8Z2|RL13A_MACFA 60S ribosomal protein L13a OS=Macaca fascicularis GN=RPL13A PE=2 SV=3 7 192 7.0E-81
sp|Q5RA38|RL13A_PONAB 60S ribosomal protein L13a OS=Pongo abelii GN=RPL13A PE=2 SV=3 7 190 1.0E-80
sp|P35427|RL13A_RAT 60S ribosomal protein L13a OS=Rattus norvegicus GN=Rpl13a PE=1 SV=2 7 190 5.0E-80
sp|Q9XSU0|RL13A_CANLF 60S ribosomal protein L13a OS=Canis lupus familiaris GN=RPL13A PE=1 SV=2 7 190 2.0E-79
sp|Q9VNE9|RL13A_DROME 60S ribosomal protein L13a OS=Drosophila melanogaster GN=RpL13A PE=1 SV=1 7 202 5.0E-79
sp|Q8MUR4|RL13A_CHOPR 60S ribosomal protein L13a OS=Choristoneura parallela GN=RpL13A PE=2 SV=1 8 202 1.0E-78
sp|Q962U0|RL13A_SPOFR 60S ribosomal protein L13a OS=Spodoptera frugiperda GN=RpL13A PE=2 SV=1 8 202 1.0E-78
sp|Q91487|RL13A_SALTR 60S ribosomal protein L13a (Fragment) OS=Salmo trutta GN=rpl13a PE=2 SV=1 16 201 3.0E-74
sp|Q27389|RL13A_CAEEL 60S ribosomal protein L13a OS=Caenorhabditis elegans GN=rpl-16 PE=2 SV=1 1 202 2.0E-73
sp|Q9LRX8|R13A2_ARATH 60S ribosomal protein L13a-2 OS=Arabidopsis thaliana GN=RPL13AB PE=1 SV=1 8 190 4.0E-73
sp|O65055|RL13A_PICMA 60S ribosomal protein L13a OS=Picea mariana GN=RPL13A PE=2 SV=1 8 183 1.0E-72
sp|Q9SFU1|R13A1_ARATH 60S ribosomal protein L13a-1 OS=Arabidopsis thaliana GN=RPL13AA PE=2 SV=1 8 190 2.0E-72
sp|Q9SVR0|R13A3_ARATH 60S ribosomal protein L13a-3 OS=Arabidopsis thaliana GN=RPL13AC PE=2 SV=1 8 187 4.0E-72
sp|Q9FKC0|R13A4_ARATH 60S ribosomal protein L13a-4 OS=Arabidopsis thaliana GN=RPL13AD PE=2 SV=1 8 190 3.0E-71
sp|Q553M7|RL13A_DICDI 60S ribosomal protein L13a OS=Dictyostelium discoideum GN=rpl13a PE=1 SV=1 8 172 3.0E-67
sp|P0DJ15|RL13A_TETTS 60S ribosomal protein L13a OS=Tetrahymena thermophila (strain SB210) GN=RPL13A PE=1 SV=1 4 202 4.0E-67
sp|O49885|RL13A_LUPLU 60S ribosomal protein L13a OS=Lupinus luteus GN=RPL13A PE=2 SV=1 8 184 5.0E-66
sp|Q95307|RL13A_PIG 60S ribosomal protein L13a (Fragment) OS=Sus scrofa GN=RPL13A PE=2 SV=2 7 143 1.0E-61
sp|Q6NVV1|R13P3_HUMAN Putative 60S ribosomal protein L13a protein RPL13AP3 OS=Homo sapiens GN=RPL13AP3 PE=5 SV=1 89 186 3.0E-30
sp|O29137|RL13_ARCFU 50S ribosomal protein L13 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl13 PE=3 SV=1 5 150 7.0E-24
sp|Q5JJF6|RL13_THEKO 50S ribosomal protein L13 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl13 PE=3 SV=1 9 151 5.0E-23
sp|Q8TT43|RL13_METAC 50S ribosomal protein L13 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl13 PE=3 SV=1 7 151 7.0E-23
sp|Q46CK6|RL13_METBF 50S ribosomal protein L13 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl13 PE=3 SV=1 7 151 1.0E-22
sp|Q8PW45|RL13_METMA 50S ribosomal protein L13 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl13 PE=3 SV=2 7 151 3.0E-22
sp|O26146|RLSX_METTH Fused L13/S9 ribosomal protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl13/rps9 PE=3 SV=1 7 152 3.0E-22
sp|Q12TI6|RL13_METBU 50S ribosomal protein L13 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl13 PE=3 SV=1 7 151 4.0E-22
sp|Q9V196|RL13_PYRAB 50S ribosomal protein L13 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl13 PE=3 SV=1 9 151 7.0E-22
sp|Q8ZYQ1|RL13_PYRAE 50S ribosomal protein L13 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl13 PE=3 SV=1 8 140 7.0E-22
sp|O59300|RL13_PYRHO 50S ribosomal protein L13 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl13 PE=1 SV=1 9 151 1.0E-21
sp|A1RSE1|RL13_PYRIL 50S ribosomal protein L13 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl13 PE=3 SV=1 8 156 1.0E-21
sp|P95991|RL13_SULSO 50S ribosomal protein L13 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl13 PE=3 SV=1 5 149 1.0E-21
sp|Q2NFZ8|RL13_METST 50S ribosomal protein L13 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl13 PE=3 SV=1 7 151 2.0E-21
sp|Q8U0E6|RL13_PYRFU 50S ribosomal protein L13 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl13 PE=1 SV=1 9 151 5.0E-21
sp|B1YC32|RL13_PYRNV 50S ribosomal protein L13 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl13 PE=3 SV=1 8 167 9.0E-21
sp|Q8TVB6|RL13_METKA 50S ribosomal protein L13 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl13 PE=3 SV=1 5 150 7.0E-20
sp|Q2FTN5|RL13_METHJ 50S ribosomal protein L13 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl13 PE=3 SV=1 7 151 7.0E-20
sp|Q74ND7|RL13_NANEQ 50S ribosomal protein L13 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl13 PE=3 SV=1 8 151 3.0E-17
sp|Q3IQT4|RL13_NATPD 50S ribosomal protein L13 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl13 PE=3 SV=1 4 148 6.0E-17
sp|P29198|RL13_HALMA 50S ribosomal protein L13 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl13 PE=1 SV=1 1 148 6.0E-17
sp|P54023|RL13_METJA 50S ribosomal protein L13 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl13 PE=3 SV=2 7 151 7.0E-17
sp|Q96YW2|RL13_SULTO 50S ribosomal protein L13 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl13 PE=3 SV=1 5 148 1.0E-14
sp|Q6L294|RL13_PICTO 50S ribosomal protein L13 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl13 PE=3 SV=1 7 152 2.0E-14
sp|Q9HQJ3|RL13_HALSA 50S ribosomal protein L13 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl13 PE=3 SV=1 1 148 5.0E-14
sp|P39473|RL13_SULAC 50S ribosomal protein L13 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl13 PE=3 SV=2 1 148 5.0E-14
sp|Q9HL07|RL13_THEAC 50S ribosomal protein L13 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl13 PE=3 SV=1 9 148 7.0E-14
sp|Q979K2|RL13_THEVO 50S ribosomal protein L13 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl13 PE=3 SV=1 9 111 9.0E-14
sp|Q9YB50|RL13_AERPE 50S ribosomal protein L13 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl13 PE=3 SV=1 8 150 1.0E-13
sp|Q18G58|RL13_HALWD 50S ribosomal protein L13 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl13 PE=3 SV=1 1 148 4.0E-13
sp|Q6LXM6|RL13_METMP 50S ribosomal protein L13 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl13 PE=3 SV=1 18 151 6.0E-13
sp|B8IZP2|RL13_DESDA 50S ribosomal protein L13 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplM PE=3 SV=1 1 114 1.0E-08
sp|A8F8P6|RL13_PSELT 50S ribosomal protein L13 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplM PE=3 SV=1 9 126 8.0E-08
sp|Q30Y43|RL13_DESAG 50S ribosomal protein L13 OS=Desulfovibrio alaskensis (strain G20) GN=rplM PE=3 SV=1 1 128 8.0E-08
sp|Q3AW67|RL13_SYNS9 50S ribosomal protein L13 OS=Synechococcus sp. (strain CC9902) GN=rplM PE=3 SV=2 9 128 3.0E-07
sp|A5EXM0|RL13_DICNV 50S ribosomal protein L13 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplM PE=3 SV=1 9 109 4.0E-07
sp|Q2LPM2|RL13_SYNAS 50S ribosomal protein L13 OS=Syntrophus aciditrophicus (strain SB) GN=rplM PE=3 SV=1 9 109 5.0E-07
sp|Q0A6F3|RL13_ALKEH 50S ribosomal protein L13 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplM PE=3 SV=1 9 109 5.0E-07
sp|Q6ANL8|RL13_DESPS 50S ribosomal protein L13 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplM PE=3 SV=1 9 122 7.0E-07
sp|Q1MQW4|RL13_LAWIP 50S ribosomal protein L13 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplM PE=3 SV=1 1 126 8.0E-07
sp|A9I237|RL13_BORPD 50S ribosomal protein L13 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplM PE=3 SV=1 9 114 8.0E-07
sp|C5BS66|RL13_TERTT 50S ribosomal protein L13 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplM PE=3 SV=1 9 128 9.0E-07
sp|Q3AMQ6|RL13_SYNSC 50S ribosomal protein L13 OS=Synechococcus sp. (strain CC9605) GN=rplM PE=3 SV=1 9 128 9.0E-07
sp|Q9SYL9|RK13_ARATH 50S ribosomal protein L13, chloroplastic OS=Arabidopsis thaliana GN=RPL13 PE=2 SV=1 1 132 1.0E-06
sp|B8DPL7|RL13_DESVM 50S ribosomal protein L13 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplM PE=3 SV=1 1 128 1.0E-06
sp|Q7V9Y8|RL13_PROMA 50S ribosomal protein L13 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplM PE=3 SV=1 9 128 3.0E-06
sp|Q9HVY2|RL13_PSEAE 50S ribosomal protein L13 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplM PE=3 SV=1 9 128 3.0E-06
sp|Q02H07|RL13_PSEAB 50S ribosomal protein L13 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplM PE=3 SV=1 9 128 3.0E-06
sp|B7UZL1|RL13_PSEA8 50S ribosomal protein L13 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplM PE=3 SV=1 9 128 3.0E-06
sp|Q318L0|RL13_PROM9 50S ribosomal protein L13 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplM PE=3 SV=1 9 114 3.0E-06
sp|Q7U4H5|RL13_SYNPX 50S ribosomal protein L13 OS=Synechococcus sp. (strain WH8102) GN=rplM PE=3 SV=1 9 128 3.0E-06
sp|A6VBA6|RL13_PSEA7 50S ribosomal protein L13 OS=Pseudomonas aeruginosa (strain PA7) GN=rplM PE=3 SV=1 9 128 4.0E-06
sp|B2IAE8|RL13_XYLF2 50S ribosomal protein L13 OS=Xylella fastidiosa (strain M23) GN=rplM PE=3 SV=1 9 128 4.0E-06
sp|B0U6Z6|RL13_XYLFM 50S ribosomal protein L13 OS=Xylella fastidiosa (strain M12) GN=rplM PE=3 SV=1 9 128 4.0E-06
sp|Q87DD3|RL13_XYLFT 50S ribosomal protein L13 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplM PE=3 SV=1 9 128 4.0E-06
sp|Q0ID31|RL13_SYNS3 50S ribosomal protein L13 OS=Synechococcus sp. (strain CC9311) GN=rplM PE=3 SV=1 9 133 4.0E-06
sp|Q9PD42|RL13_XYLFA 50S ribosomal protein L13 OS=Xylella fastidiosa (strain 9a5c) GN=rplM PE=3 SV=1 9 128 5.0E-06
sp|Q7V521|RL13_PROMM 50S ribosomal protein L13 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplM PE=3 SV=1 9 128 5.0E-06
sp|A2CC54|RL13_PROM3 50S ribosomal protein L13 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplM PE=3 SV=1 9 128 5.0E-06
sp|A1K971|RL13_AZOSB 50S ribosomal protein L13 OS=Azoarcus sp. (strain BH72) GN=rplM PE=3 SV=1 9 114 5.0E-06
sp|A5GIR9|RL13_SYNPW 50S ribosomal protein L13 OS=Synechococcus sp. (strain WH7803) GN=rplM PE=3 SV=1 9 114 6.0E-06
sp|A6VXZ3|RL13_MARMS 50S ribosomal protein L13 OS=Marinomonas sp. (strain MWYL1) GN=rplM PE=3 SV=1 9 128 7.0E-06
sp|C1D166|RL13_DEIDV 50S ribosomal protein L13 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rplM PE=3 SV=1 8 128 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4790
MSTFEPVVIIDGKGHLLGRLASIVAKQLLNGQKIVIVRCEELNISGEFFRAKLKYHAYLRKMTRYNPTRGGPFHF
RAPSRIFYKAVRGMMPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALRVLRLQPGRKYCTVGRLSHEVGWK
YQDVVARLEERRKAKGLAYYERKKVAARQLSDAKKNAATKPETAKALAAYGY*
Coding >OphauB2|4790
ATGTCGACATTTGAGCCGGTTGTCATCATCGACGGCAAAGGCCACCTCTTGGGTCGCTTAGCTAGCATCGTCGCT
AAGCAACTGCTCAATGGCCAAAAGATTGTCATTGTGCGCTGCGAGGAACTCAACATTTCTGGCGAGTTCTTCCGC
GCCAAGCTCAAGTATCACGCCTACCTACGGAAGATGACTCGATACAATCCCACCCGCGGTGGACCTTTCCATTTC
CGAGCCCCCTCTAGAATTTTCTACAAGGCTGTTCGCGGCATGATGCCTCACAAGACAGCGCGTGGCGCAGCTGCC
CTCGAGCGTCTCAAGGTTTTCGAGGGTGTTCCTCCCCCATACGACAAGAAGAAGAAGATGGTTGTACCGCAGGCT
CTCCGAGTCTTGCGTCTGCAGCCTGGCCGCAAGTACTGCACTGTTGGCCGGCTGAGCCATGAAGTTGGCTGGAAG
TACCAGGATGTTGTTGCTCGATTGGAGGAGCGAAGAAAGGCCAAGGGCCTTGCCTATTACGAGCGCAAGAAGGTT
GCTGCCCGACAACTCTCCGATGCGAAAAAGAACGCTGCCACCAAGCCCGAGACGGCCAAGGCCCTTGCTGCGTAT
GGCTATTAA
Transcript >OphauB2|4790
ATGTCGACATTTGAGCCGGTTGTCATCATCGACGGCAAAGGCCACCTCTTGGGTCGCTTAGCTAGCATCGTCGCT
AAGCAACTGCTCAATGGCCAAAAGATTGTCATTGTGCGCTGCGAGGAACTCAACATTTCTGGCGAGTTCTTCCGC
GCCAAGCTCAAGTATCACGCCTACCTACGGAAGATGACTCGATACAATCCCACCCGCGGTGGACCTTTCCATTTC
CGAGCCCCCTCTAGAATTTTCTACAAGGCTGTTCGCGGCATGATGCCTCACAAGACAGCGCGTGGCGCAGCTGCC
CTCGAGCGTCTCAAGGTTTTCGAGGGTGTTCCTCCCCCATACGACAAGAAGAAGAAGATGGTTGTACCGCAGGCT
CTCCGAGTCTTGCGTCTGCAGCCTGGCCGCAAGTACTGCACTGTTGGCCGGCTGAGCCATGAAGTTGGCTGGAAG
TACCAGGATGTTGTTGCTCGATTGGAGGAGCGAAGAAAGGCCAAGGGCCTTGCCTATTACGAGCGCAAGAAGGTT
GCTGCCCGACAACTCTCCGATGCGAAAAAGAACGCTGCCACCAAGCCCGAGACGGCCAAGGCCCTTGCTGCGTAT
GGCTATTAA
Gene >OphauB2|4790
ATGTCGACATTTGAGCCGGTTGTAAGTAATCAAAGCCATACTGTCATTGACTATGTCACGATGCGCACAAGATTC
GAGAGACTTGAAGGACTTGAGTTACTTGAGGGCAGGCACTTGTCGACTTGTTGTCCCAGCGCTGCAGCGCAAGCA
TACGTCTTGCATCATATTGGGGCTAACGTGGAGTGACTGACAGGTCATCATCGACGGCAAAGGCCACCTCTTGGG
TCGCTTAGCTAGCATCGTCGCTAAGCAACTGCTCAATGGCCAAAAGATTGTCATTGTGCGCTGCGAGGAACTCAA
CATTTCTGGCGAGTTCTTCCGCGCCAAGCGTACGTCACCATTTACTTGATGTTCCATCCACCAGCAAACATTGCG
ACGGCAACCGTTTGGCTTGCAGGCAGATCCCCTCGAATCTCTACCAAAGACTAACTCTTGGTAGTCAAGTATCAC
GCCTACCTACGGAAGATGACTCGATACAATCCCACCCGCGGTGGTGAGTCCCAATTCCTTGCCCAAACCGCGCGC
CTATCCCTTCTGACCAGGCACCAGGACCTTTCCATTTCCGAGCCCCCTCTAGAATTTTCTACAAGGCTGTTCGCG
GCATGATGCCTCACAAGACAGCGCGTGGCGCAGCTGCCCTCGAGCGTCTCAAGGTTTTCGAGGGTGTTCCTCCCC
CATACGACAAGAAGAAGAAGATGGTTGTACCGCAGGCTCTCCGAGTCTTGCGTCTGCAGCCTGGCCGCAAGTACT
GCACTGTTGGCCGGCTGAGCCATGAAGTTGGCTGGAAGTACCAGGATGTTGTTGCTCGGTAAGTCTCAAACTGAA
AATGTGCGACTTGGGGCATGCATTAATTATATTGGCAGATTGGAGGAGCGAAGAAAGGCCAAGGGCCTTGCCTAT
TACGAGCGCAAGAAGGTTGCTGCCCGACAACTCTCCGATGCGAAAAAGAACGCTGCCACCAAGCCCGAGACGGCC
AAGGCCCTTGCTGCGTATGGCTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail