Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4784
Gene name
LocationContig_33:103715..104414
Strand+
Gene length (bp)699
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01323 DSBA DSBA-like thioredoxin domain 1.3E-31 7 211

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39598|YWBO_BACSU Uncharacterized protein YwbO OS=Bacillus subtilis (strain 168) GN=ywbO PE=4 SV=1 6 193 9.0E-08

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4784
MTKFCISVTSDTVCPWCYIGRRQLQRAQSLWLQQAANTGDSFSVTFLPYQLEPAWPRGPDSSRDKQQFYSSKFGA
QRTRLMQQRLDLVGSQLGISFRHGGRTGNSRDSHRLVHLAKAYGNGVELAVVDGLFAAYFEKEQDITSHHVLRDI
ATRAGIPAQDFQEELVDGDRGGAEVDAAASLARSRGITGVPFFDFQSRFHVSGARDAKDFLHIFEKIKAHENGQD
VSDTELD*
Coding >OphauB2|4784
ATGACCAAGTTTTGCATCTCCGTCACTTCAGACACAGTCTGTCCCTGGTGCTACATTGGCCGCCGCCAGCTCCAG
CGCGCCCAAAGCCTCTGGCTGCAACAAGCCGCAAACACTGGCGACTCCTTCTCCGTCACTTTTCTCCCCTACCAG
CTCGAGCCAGCATGGCCCCGTGGGCCCGACTCAAGCCGCGACAAGCAGCAGTTTTACAGTAGCAAATTCGGCGCC
CAGCGCACCCGCCTCATGCAGCAGCGTCTCGACCTTGTTGGCAGCCAGCTCGGCATCAGCTTTAGACATGGCGGC
CGGACTGGCAACTCTAGAGATTCGCATCGCTTGGTTCATCTCGCAAAGGCATATGGCAATGGTGTCGAGCTCGCT
GTTGTGGATGGCTTGTTTGCTGCCTACTTTGAAAAGGAGCAGGACATTACCTCGCATCATGTCCTGCGCGATATT
GCCACCCGTGCCGGTATTCCGGCGCAAGACTTTCAAGAGGAACTTGTAGATGGCGACAGGGGTGGTGCCGAGGTT
GATGCAGCGGCGTCGCTGGCACGGTCTCGCGGCATTACTGGTGTTCCCTTTTTCGATTTTCAGAGCCGTTTTCAC
GTCAGTGGCGCACGAGACGCCAAGGATTTCCTGCATATATTCGAAAAAATCAAGGCTCATGAAAACGGCCAAGAC
GTTTCCGATACAGAGCTGGATTAG
Transcript >OphauB2|4784
ATGACCAAGTTTTGCATCTCCGTCACTTCAGACACAGTCTGTCCCTGGTGCTACATTGGCCGCCGCCAGCTCCAG
CGCGCCCAAAGCCTCTGGCTGCAACAAGCCGCAAACACTGGCGACTCCTTCTCCGTCACTTTTCTCCCCTACCAG
CTCGAGCCAGCATGGCCCCGTGGGCCCGACTCAAGCCGCGACAAGCAGCAGTTTTACAGTAGCAAATTCGGCGCC
CAGCGCACCCGCCTCATGCAGCAGCGTCTCGACCTTGTTGGCAGCCAGCTCGGCATCAGCTTTAGACATGGCGGC
CGGACTGGCAACTCTAGAGATTCGCATCGCTTGGTTCATCTCGCAAAGGCATATGGCAATGGTGTCGAGCTCGCT
GTTGTGGATGGCTTGTTTGCTGCCTACTTTGAAAAGGAGCAGGACATTACCTCGCATCATGTCCTGCGCGATATT
GCCACCCGTGCCGGTATTCCGGCGCAAGACTTTCAAGAGGAACTTGTAGATGGCGACAGGGGTGGTGCCGAGGTT
GATGCAGCGGCGTCGCTGGCACGGTCTCGCGGCATTACTGGTGTTCCCTTTTTCGATTTTCAGAGCCGTTTTCAC
GTCAGTGGCGCACGAGACGCCAAGGATTTCCTGCATATATTCGAAAAAATCAAGGCTCATGAAAACGGCCAAGAC
GTTTCCGATACAGAGCTGGATTAG
Gene >OphauB2|4784
ATGACCAAGTTTTGCATCTCCGTCACTTCAGACACAGTCTGTCCCTGGTGCTACATTGGCCGCCGCCAGCTCCAG
CGCGCCCAAAGCCTCTGGCTGCAACAAGCCGCAAACACTGGCGACTCCTTCTCCGTCACTTTTCTCCCCTACCAG
CTCGAGCCAGCATGGCCCCGTGGGCCCGACTCAAGCCGCGACAAGCAGCAGTTTTACAGTAGCAAATTCGGCGCC
CAGCGCACCCGCCTCATGCAGCAGCGTCTCGACCTTGTTGGCAGCCAGCTCGGCATCAGCTTTAGACATGGCGGC
CGGACTGGCAACTCTAGAGATTCGCATCGCTTGGTTCATCTCGCAAAGGCATATGGCAATGGTGTCGAGCTCGCT
GTTGTGGATGGCTTGTTTGCTGCCTACTTTGAAAAGGAGCAGGACATTACCTCGCATCATGTCCTGCGCGATATT
GCCACCCGTGCCGGTATTCCGGCGCAAGACTTTCAAGAGGAACTTGTAGATGGCGACAGGGGTGGTGCCGAGGTT
GATGCAGCGGCGTCGCTGGCACGGTCTCGCGGCATTACTGGTGTTCCCTTTTTCGATTTTCAGAGCCGTTTTCAC
GTCAGTGGCGCACGAGACGCCAAGGATTTCCTGCATATATTCGAAAAAATCAAGGCTCATGAAAACGGCCAAGAC
GTTTCCGATACAGAGCTGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail