Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4777
Gene name
LocationContig_33:84059..84905
Strand+
Gene length (bp)846
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 2.4E-24 29 145

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8TG42|MP1_ASPFL Cell wall mannoprotein 1 OS=Aspergillus flavus GN=mp1 PE=2 SV=1 1 173 2.0E-18
sp|Q9HFP8|MP1_ASPFM Cell wall mannoprotein 1 OS=Neosartorya fumigata GN=MP1 PE=1 SV=1 1 173 2.0E-17
sp|O42721|MP1_TALMA Cell wall mannoprotein 1 OS=Talaromyces marneffei GN=MP1 PE=1 SV=1 25 254 7.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 26 0.999736

Transmembrane Domains

Domain # Start End Length
1 258 280 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup292
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|465
Ophiocordyceps australis 1348a (Ghana) OphauG2|4942
Ophiocordyceps australis map64 (Brazil) OphauB2|2064
Ophiocordyceps australis map64 (Brazil) OphauB2|4777 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02984
Ophiocordyceps camponoti-rufipedis Ophun1|5325
Ophiocordyceps kimflemingae Ophio5|2465
Ophiocordyceps kimflemingae Ophio5|7349
Ophiocordyceps subramaniannii Hirsu2|6902
Ophiocordyceps subramaniannii Hirsu2|7182

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4777
MKFSAVTVACMATGVLATPPTRVYERDLATITGILSSVGSDIDSLGNTVQGYNGDAGPVVSSADKLISTLKDGTT
KAEGSSQLDLTGALGLQQPVKDLQSKAENLLTQFKSKKQTIEEAGQCGTVREKLSSIDSNGQALIKAIVSKVPTE
AQGIANGLAAGLQGVLSQAADEFSMSKCMDKGGNSSGGSSATSAPGTSAGSSAPATSATATGGGSTGAYPMPSTG
PTGGYSTPANGGGYPAPTGGVPTGAPTMPGAPVVTAGAALVAPAGIMAAAMAAILL*
Coding >OphauB2|4777
ATGAAGTTCTCTGCAGTCACCGTTGCGTGCATGGCCACTGGCGTCCTGGCCACACCTCCCACACGCGTCTACGAG
CGGGACCTTGCCACCATTACCGGCATCCTCAGCTCGGTTGGCAGCGACATCGACTCCCTCGGCAACACGGTCCAG
GGCTACAATGGCGATGCTGGGCCCGTTGTGTCCTCTGCCGACAAGCTCATCTCGACGCTCAAGGACGGTACAACC
AAGGCCGAGGGTTCATCCCAACTGGATCTTACCGGCGCTCTGGGTCTTCAGCAACCCGTCAAGGATCTCCAGTCC
AAGGCGGAGAACCTCTTGACCCAGTTCAAGTCAAAGAAGCAGACGATTGAGGAGGCGGGCCAGTGCGGCACTGTC
CGCGAGAAGCTCAGCTCCATCGACTCCAACGGCCAAGCCCTCATCAAGGCCATTGTCAGCAAGGTTCCCACCGAG
GCCCAGGGCATCGCCAATGGCCTTGCTGCCGGCCTTCAGGGCGTCTTGAGCCAGGCTGCTGATGAGTTCAGCATG
TCCAAGTGCATGGACAAGGGCGGAAACTCGTCGGGCGGCTCCTCTGCCACGTCTGCCCCTGGAACCTCTGCCGGC
AGCTCTGCTCCCGCCACGTCTGCCACGGCCACTGGTGGAGGTTCTACTGGTGCTTACCCCATGCCCTCGACTGGT
CCCACTGGCGGCTACTCTACTCCTGCCAATGGCGGCGGCTATCCCGCGCCCACGGGTGGTGTCCCTACTGGTGCC
CCCACGATGCCCGGTGCACCCGTTGTTACTGCCGGCGCTGCCCTTGTGGCTCCCGCTGGTATCATGGCTGCTGCC
ATGGCTGCCATTCTCTTGTAG
Transcript >OphauB2|4777
ATGAAGTTCTCTGCAGTCACCGTTGCGTGCATGGCCACTGGCGTCCTGGCCACACCTCCCACACGCGTCTACGAG
CGGGACCTTGCCACCATTACCGGCATCCTCAGCTCGGTTGGCAGCGACATCGACTCCCTCGGCAACACGGTCCAG
GGCTACAATGGCGATGCTGGGCCCGTTGTGTCCTCTGCCGACAAGCTCATCTCGACGCTCAAGGACGGTACAACC
AAGGCCGAGGGTTCATCCCAACTGGATCTTACCGGCGCTCTGGGTCTTCAGCAACCCGTCAAGGATCTCCAGTCC
AAGGCGGAGAACCTCTTGACCCAGTTCAAGTCAAAGAAGCAGACGATTGAGGAGGCGGGCCAGTGCGGCACTGTC
CGCGAGAAGCTCAGCTCCATCGACTCCAACGGCCAAGCCCTCATCAAGGCCATTGTCAGCAAGGTTCCCACCGAG
GCCCAGGGCATCGCCAATGGCCTTGCTGCCGGCCTTCAGGGCGTCTTGAGCCAGGCTGCTGATGAGTTCAGCATG
TCCAAGTGCATGGACAAGGGCGGAAACTCGTCGGGCGGCTCCTCTGCCACGTCTGCCCCTGGAACCTCTGCCGGC
AGCTCTGCTCCCGCCACGTCTGCCACGGCCACTGGTGGAGGTTCTACTGGTGCTTACCCCATGCCCTCGACTGGT
CCCACTGGCGGCTACTCTACTCCTGCCAATGGCGGCGGCTATCCCGCGCCCACGGGTGGTGTCCCTACTGGTGCC
CCCACGATGCCCGGTGCACCCGTTGTTACTGCCGGCGCTGCCCTTGTGGCTCCCGCTGGTATCATGGCTGCTGCC
ATGGCTGCCATTCTCTTGTAG
Gene >OphauB2|4777
ATGAAGTTCTCTGCAGTCACCGTTGCGTGCATGGCCACTGGCGTCCTGGCCACACCTCCCACACGCGTCTACGAG
CGGGACCTTGCCACCATTACCGGCATCCTCAGCTCGGTTGGCAGCGACATCGACTCCCTCGGCAACACGGTCCAG
GGCTACAATGGCGATGCTGGGCCCGTTGTGTCCTCTGCCGACAAGCTCATCTCGACGCTCAAGGACGGTACAACC
AAGGCCGAGGGTTCATCCCAACTGGATCTTACCGGCGCTCTGGGTCTTCAGCAACCCGTCAAGGATCTCCAGTCC
AAGGCGGAGAACCTCTTGACCCAGTTCAAGTCAAAGAAGCAGACGATTGAGGAGGCGGGCCAGTGCGGCACTGTC
CGCGAGAAGCTCAGCTCCATCGACTCCAACGGCCAAGCCCTCATCAAGGCCATTGTCAGCAAGGTTCCCACCGAG
GCCCAGGGCATCGCCAATGGCCTTGCTGCCGGCCTTCAGGGCGTCTTGAGCCAGGCTGCTGATGAGTTCAGCATG
TCCAAGTGCATGGACAAGGGCGGAAACTCGTCGGGCGGCTCCTCTGCCACGTCTGCCCCTGGAACCTCTGCCGGC
AGCTCTGCTCCCGCCACGTCTGCCACGGCCACTGGTGGAGGTTCTACTGGTGCTTACCCCATGCCCTCGACTGGT
CCCACTGGCGGCTACTCTACTCCTGCCAATGGCGGCGGCTATCCCGCGCCCACGGGTGGTGTCCCTACTGGTGCC
CCCACGATGCCCGGTGCACCCGTTGTTACTGCCGGCGCTGCCCTTGTGGCTCCCGCTGGTATCATGGCTGCTGCC
ATGGCTGCCATTCTCTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail