Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4776
Gene name
LocationContig_33:73491..76422
Strand-
Gene length (bp)2931
Transcript length (bp)2931
Coding sequence length (bp)2931
Protein length (aa) 977

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 2.1E-51 450 638
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.2E-26 657 867
PF00403 HMA Heavy-metal-associated domain 2.6E-10 171 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 156 966 0.0E+00
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 171 967 5.0E-98
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 171 967 5.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 156 966 0.0E+00
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 171 967 5.0E-98
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 171 967 5.0E-98
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 171 967 8.0E-98
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 171 967 8.0E-98
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 171 967 8.0E-98
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 171 959 9.0E-98
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 171 967 1.0E-97
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 171 967 1.0E-97
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 171 967 2.0E-97
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 166 961 5.0E-97
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 171 967 5.0E-97
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 171 944 1.0E-95
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 171 944 2.0E-94
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 171 938 2.0E-88
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 314 955 5.0E-88
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 169 961 4.0E-87
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 169 961 4.0E-87
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 171 938 2.0E-86
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 166 936 4.0E-86
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 169 961 6.0E-85
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 171 938 2.0E-84
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 171 937 4.0E-84
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 171 933 6.0E-83
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 166 967 3.0E-82
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 121 936 6.0E-82
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 171 936 1.0E-81
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 351 961 3.0E-81
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 383 961 5.0E-81
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 166 936 1.0E-80
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 171 936 4.0E-80
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 171 949 6.0E-80
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 382 955 1.0E-79
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 382 955 1.0E-79
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 383 938 8.0E-77
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 170 949 6.0E-74
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 309 962 7.0E-74
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 322 967 1.0E-73
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 329 941 4.0E-72
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 329 941 8.0E-72
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 329 933 1.0E-71
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 329 967 2.0E-71
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 329 967 2.0E-71
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 324 966 5.0E-68
sp|O08462|COPA3_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 272 968 8.0E-68
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 272 968 1.0E-67
sp|B9DFX7|HMA8_ARATH Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 380 972 2.0E-67
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 159 729 2.0E-67
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 272 968 2.0E-66
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 169 968 5.0E-66
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 351 936 9.0E-66
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 241 962 1.0E-65
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 272 968 2.0E-65
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 351 936 2.0E-65
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 272 968 3.0E-65
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 314 962 4.0E-65
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 169 962 4.0E-65
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 169 968 4.0E-65
sp|Q9SZC9|HMA6_ARATH Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 379 944 2.0E-64
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 353 966 1.0E-63
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 169 955 2.0E-62
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 169 955 2.0E-62
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 351 933 6.0E-62
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 261 962 7.0E-62
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 261 962 5.0E-61
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 149 928 1.0E-60
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 169 961 2.0E-59
sp|O33533|FIXI_RHILV Nitrogen fixation protein FixI OS=Rhizobium leguminosarum bv. viciae GN=fixI PE=3 SV=1 254 933 3.0E-59
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 421 928 8.0E-58
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 420 928 2.0E-57
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 420 928 3.0E-57
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 358 955 4.0E-56
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 407 970 2.0E-53
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 416 955 3.0E-53
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 383 955 5.0E-52
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 383 955 5.0E-52
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 383 955 5.0E-52
sp|Q59207|FIXI_BRADU Nitrogen fixation protein FixI OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixI PE=3 SV=1 323 935 2.0E-49
sp|P18398|FIXI_RHIME Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 354 929 4.0E-49
sp|Q9RQB4|HMCT_HELFE Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 396 920 4.0E-49
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 367 934 8.0E-49
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 421 928 1.0E-48
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 421 918 1.0E-47
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 381 934 2.0E-46
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 404 892 3.0E-44
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 317 939 4.0E-43
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 416 859 3.0E-42
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 416 859 3.0E-42
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 416 859 3.0E-42
sp|A0R3A7|CTPD_MYCS2 Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 380 920 2.0E-41
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 398 904 2.0E-41
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 417 927 4.0E-41
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 459 931 5.0E-41
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 368 921 1.0E-40
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 368 921 1.0E-40
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 404 891 6.0E-40
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 417 927 1.0E-39
sp|P0CW77|HMA3A_ARATH Putative inactive cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=5 SV=1 367 764 1.0E-37
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 463 931 5.0E-36
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 463 931 5.0E-36
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 463 931 5.0E-36
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 446 892 2.0E-34
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 446 892 2.0E-34
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 446 892 2.0E-34
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 435 880 6.0E-29
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 422 874 6.0E-27
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 443 892 6.0E-27
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 427 874 9.0E-26
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 427 893 2.0E-25
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 420 892 2.0E-25
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 420 892 2.0E-25
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 420 892 3.0E-25
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 422 874 3.0E-25
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 422 874 3.0E-25
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 422 874 3.0E-25
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 422 874 3.0E-25
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 423 892 5.0E-25
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 421 892 8.0E-25
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 420 892 9.0E-25
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 420 892 1.0E-24
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 420 892 2.0E-24
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 420 892 2.0E-24
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 422 892 3.0E-24
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 446 928 3.0E-24
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 421 892 3.0E-24
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 420 892 3.0E-24
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 420 892 6.0E-24
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 420 892 7.0E-24
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 420 892 8.0E-24
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 407 892 1.0E-22
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 407 892 1.0E-22
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 407 892 1.0E-22
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 404 928 1.0E-22
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 412 928 1.0E-22
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 399 892 3.0E-22
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 471 872 4.0E-22
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 459 874 1.0E-21
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 420 880 2.0E-21
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 427 872 2.0E-21
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 427 880 2.0E-21
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 435 874 2.0E-21
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 435 874 2.0E-21
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 435 874 2.0E-21
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 435 874 2.0E-21
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 435 874 2.0E-21
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 435 874 3.0E-21
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 435 874 3.0E-21
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 446 892 4.0E-21
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 471 872 5.0E-21
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 446 892 5.0E-21
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 459 880 7.0E-21
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 465 880 8.0E-21
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 465 872 1.0E-20
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 465 872 1.0E-20
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 437 872 1.0E-20
sp|Q9M3H5|HMA1_ARATH Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic OS=Arabidopsis thaliana GN=HMA1 PE=2 SV=2 471 891 1.0E-20
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 430 880 1.0E-20
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 430 880 1.0E-20
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 430 880 1.0E-20
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 435 874 1.0E-20
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 430 880 1.0E-20
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 420 880 1.0E-20
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 430 880 1.0E-20
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 430 880 1.0E-20
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 430 880 1.0E-20
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 465 872 2.0E-20
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 443 892 2.0E-20
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 430 872 2.0E-20
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 446 928 2.0E-20
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 430 880 2.0E-20
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 435 874 2.0E-20
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 430 880 3.0E-20
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 430 880 3.0E-20
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 423 892 3.0E-20
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 368 880 4.0E-20
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 430 880 4.0E-20
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 430 880 5.0E-20
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 430 880 5.0E-20
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 430 880 5.0E-20
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 430 880 5.0E-20
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 430 880 5.0E-20
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 471 880 6.0E-20
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 446 892 6.0E-20
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 430 880 6.0E-20
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 430 892 7.0E-20
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 471 880 9.0E-20
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 471 880 9.0E-20
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 443 961 1.0E-19
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 465 872 1.0E-19
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 454 911 3.0E-19
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 471 880 3.0E-19
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 366 880 4.0E-19
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 366 880 4.0E-19
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 366 880 5.0E-19
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 366 880 5.0E-19
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 366 880 5.0E-19
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 366 880 5.0E-19
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 366 880 5.0E-19
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 366 880 5.0E-19
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 366 880 5.0E-19
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 381 872 6.0E-19
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 427 872 6.0E-19
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 466 874 9.0E-19
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 461 892 1.0E-18
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 422 880 1.0E-18
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 422 880 1.0E-18
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 471 880 1.0E-18
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 447 967 2.0E-18
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 405 880 2.0E-18
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 446 928 3.0E-18
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 471 880 4.0E-18
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 366 880 1.0E-17
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 454 911 1.0E-17
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 465 880 2.0E-17
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 366 880 2.0E-17
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 454 928 2.0E-17
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 454 911 3.0E-17
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 419 874 9.0E-17
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 454 911 9.0E-17
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 454 911 2.0E-16
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 454 911 2.0E-16
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 454 940 2.0E-16
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 446 928 2.0E-16
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 460 880 4.0E-16
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 761 936 7.0E-16
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 454 940 1.0E-15
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 454 911 1.0E-15
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 454 940 1.0E-15
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 396 928 3.0E-15
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 454 911 3.0E-15
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 454 940 5.0E-15
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 446 928 6.0E-15
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 422 958 7.0E-15
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 454 911 8.0E-15
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 454 940 9.0E-15
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 454 940 2.0E-14
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 468 892 4.0E-14
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 454 911 5.0E-14
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 454 911 8.0E-14
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 421 699 9.0E-14
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 474 923 1.0E-13
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 357 669 1.0E-13
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 422 911 1.0E-13
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 421 699 1.0E-13
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 420 674 1.0E-11
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 399 674 5.0E-11
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 399 672 1.0E-10
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 421 911 2.0E-10
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 420 681 2.0E-10
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 404 674 2.0E-09
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 404 674 2.0E-09
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 404 674 3.0E-09
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 423 890 3.0E-09
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 404 674 4.0E-09
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 404 674 4.0E-09
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 404 674 4.0E-09
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 404 674 4.0E-09
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 400 674 4.0E-09
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 387 674 5.0E-09
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 404 674 5.0E-09
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 404 674 5.0E-09
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 404 674 5.0E-09
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 404 674 8.0E-09
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 423 674 1.0E-08
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 423 674 1.0E-08
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 446 674 1.0E-08
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 446 674 1.0E-08
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 474 692 1.0E-08
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 422 692 2.0E-08
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 446 674 2.0E-08
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 446 674 2.0E-08
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 446 674 2.0E-08
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 407 674 2.0E-08
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 446 674 2.0E-08
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 423 674 2.0E-08
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 446 674 2.0E-08
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 446 674 3.0E-08
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 446 674 3.0E-08
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 384 681 3.0E-08
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 446 674 3.0E-08
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 446 674 3.0E-08
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 415 681 3.0E-08
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 407 674 4.0E-08
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 385 670 4.0E-08
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 423 674 4.0E-08
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 395 674 4.0E-08
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 384 679 5.0E-08
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 446 674 5.0E-08
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 431 674 6.0E-08
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 446 674 6.0E-08
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 426 674 7.0E-08
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 404 674 8.0E-08
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 462 672 1.0E-07
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 462 672 1.0E-07
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 446 674 1.0E-07
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 446 674 1.0E-07
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 497 892 1.0E-07
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 497 892 1.0E-07
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 497 892 1.0E-07
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 474 672 2.0E-07
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 446 674 2.0E-07
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 443 672 2.0E-07
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 446 674 3.0E-07
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 404 674 3.0E-07
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 423 674 3.0E-07
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 443 672 4.0E-07
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 422 684 4.0E-07
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 462 672 6.0E-07
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 400 674 7.0E-07
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 446 674 8.0E-07
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 422 674 9.0E-07
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 774 934 1.0E-06
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 404 674 1.0E-06
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 384 673 1.0E-06
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 798 892 2.0E-06
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 642 880 3.0E-06
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 446 674 3.0E-06
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 464 670 7.0E-06
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 423 670 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 320 342 22
2 349 371 22
3 386 408 22
4 566 588 22
5 608 630 22
6 912 934 22
7 944 963 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup373
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1321
Ophiocordyceps australis map64 (Brazil) OphauB2|4776 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02982
Ophiocordyceps camponoti-rufipedis Ophun1|5321
Ophiocordyceps kimflemingae Ophio5|4426
Ophiocordyceps kimflemingae Ophio5|7351
Ophiocordyceps subramaniannii Hirsu2|10343
Ophiocordyceps subramaniannii Hirsu2|11034
Ophiocordyceps subramaniannii Hirsu2|7397

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4776
MAQRLVTGTAGRGNTHKTESNGGSTCSAHLSRAFEQYSAYLESARRICQKVLRRAWPSRRCDDKPGQAARLDGAE
MSRTVDQDPIQHDHHHHHHHHHGGIKCHATGEPPTLNAMKPLAQLKSATSKKTGCCSTAHAREPKDAHAGWAMMD
GSTRTDEVDLEKAKGQEWIVLSVTGMTCSGCANKMERTLCSFAGVSSVRVNFVMSSAEFRLDDSSAASLQHIIRG
VEKATGFGCTRVSTREQSIDVLASGDSAKALTKLPLPGVTQVTVISNKIVRIGYDARVVGARELVQRISSLSCGL
APPGDDASIWRGRRRLHDQLVLTMIAGAFTLPIVIMAWSDNLVDRYTQGCVCLVFATIVQLVAVPVFYRPAVAAL
VHSGSLEMDMLIVISITAAYTYSVVAFGFLMVGKSVGMESFFETSSLLITLVLLGRLMAAFARMRAVEAVSLRSL
QSNKAIIVQGGREQEIDARLLQYGDVVRVEPHSTVPTDGIVTEGWSEVDESMLTGESVPVTKQRDDTVIAGTVNG
SGVLTARLTRLPGNNTVADIAQLVEEAANSKPRLQDIADGIAAWFVPVVSCMAVIVLVVWMVVGVRVRGYSGGRA
VSVAITYAVATLAVSCPCALGLAVPMVLVVAGGMAARKGVIIKSAECTERARKVTDVVFDKTGTITEGELQVTHE
ELLGPDEEAIVGVARCLAAGNKHPVSLAVAKHLQQRRGPRVRLSDMQVVPGAGVEAVHGSDVFRAGSPSWTATAD
HGLIVRLQAMGRTLLVVTRNGEPVAVFALLTRVRAEAAGVVHRLVQSGIRVHLVSGDQMGAVMTVAAQVGIFNVA
AQCTPSDKRDYVASLMATPRRPRIVMFVGDGTNDAVAVTQADVGVQLASVVSASHVTRGAADVVLLNGLEGVVLL
LRISAIAFRRMLFNFVWSAAYNVLALLFASGALVNVRIPPAYAGLGEMFSVLPVIGAAVTMLFQRIRTNDGAGLC
T*
Coding >OphauB2|4776
ATGGCTCAACGACTAGTCACAGGCACTGCCGGCCGCGGCAACACGCACAAGACCGAGTCCAACGGAGGGTCGACG
TGCAGCGCGCATCTCTCAAGGGCCTTTGAGCAGTACAGCGCCTACCTAGAGTCGGCCCGGCGAATTTGCCAAAAG
GTGCTCAGGCGTGCATGGCCGTCGAGACGCTGCGACGACAAGCCAGGACAAGCGGCTCGGCTCGACGGCGCTGAA
ATGAGTCGGACAGTTGACCAAGACCCCATTCAACATGACCATCATCATCATCATCACCACCACCATGGAGGCATC
AAGTGTCATGCAACTGGCGAACCCCCAACTCTCAACGCCATGAAGCCTCTAGCCCAGCTCAAGTCGGCCACAAGC
AAAAAGACTGGATGCTGCAGCACAGCCCACGCTAGAGAGCCCAAGGACGCGCATGCCGGCTGGGCCATGATGGAC
GGCAGCACGCGGACCGACGAGGTGGATCTCGAAAAAGCAAAGGGGCAGGAATGGATTGTGCTGAGCGTCACGGGC
ATGACGTGCTCGGGATGCGCCAACAAGATGGAGCGCACGCTGTGCTCCTTTGCGGGCGTCTCGTCGGTGCGGGTA
AACTTTGTCATGAGCTCGGCCGAGTTTAGACTCGACGACTCGTCGGCCGCGTCGCTGCAGCACATTATCCGTGGG
GTGGAAAAGGCAACGGGCTTTGGCTGCACGCGCGTGTCGACTAGGGAGCAGAGCATCGACGTGCTGGCCTCGGGC
GACTCGGCCAAGGCGCTGACCAAGCTGCCGCTGCCGGGGGTGACGCAGGTGACGGTGATTAGCAACAAGATTGTG
CGCATTGGGTATGATGCGAGGGTGGTGGGCGCCAGGGAGCTGGTTCAGAGGATCAGCTCGCTGTCGTGTGGGCTG
GCGCCGCCTGGCGACGACGCGAGCATTTGGCGCGGCCGACGGCGCCTCCACGACCAGCTCGTCTTGACCATGATT
GCCGGGGCCTTTACCCTGCCCATTGTCATCATGGCGTGGAGCGACAACTTGGTTGACCGGTATACCCAAGGCTGT
GTGTGCCTCGTCTTTGCCACCATTGTGCAGCTGGTGGCGGTGCCCGTCTTTTACCGTCCAGCAGTGGCGGCACTG
GTGCACAGTGGGTCGCTGGAAATGGACATGCTCATTGTCATTAGCATCACGGCGGCCTACACGTACTCGGTGGTG
GCGTTTGGCTTCCTCATGGTGGGCAAGAGCGTGGGCATGGAGTCGTTTTTCGAGACGAGCTCCTTGCTCATTACG
CTGGTGCTGCTGGGGCGGCTCATGGCTGCGTTTGCGCGGATGCGGGCGGTTGAAGCCGTGTCGCTGCGCTCGCTG
CAGTCCAACAAGGCCATTATTGTGCAGGGCGGGCGGGAGCAAGAGATTGATGCTCGGCTGCTGCAGTATGGCGAT
GTGGTGCGGGTTGAGCCGCACTCGACAGTGCCGACGGACGGCATTGTGACGGAGGGATGGAGCGAGGTGGACGAG
TCGATGCTGACGGGCGAGAGCGTGCCGGTGACGAAGCAGAGAGACGACACGGTGATTGCAGGCACGGTCAACGGG
TCGGGCGTCTTGACGGCACGGCTGACGCGTCTGCCGGGCAACAACACGGTGGCGGACATTGCGCAGCTGGTGGAG
GAGGCGGCCAACTCGAAGCCGCGGCTGCAGGACATTGCAGACGGGATTGCGGCGTGGTTTGTGCCCGTGGTGAGC
TGCATGGCCGTCATTGTGCTTGTGGTGTGGATGGTTGTGGGGGTGCGGGTGCGCGGCTACAGCGGCGGGCGGGCG
GTTTCCGTCGCCATCACGTATGCCGTTGCCACGCTGGCCGTGTCGTGTCCGTGTGCGCTGGGGCTGGCAGTGCCC
ATGGTGCTGGTGGTGGCGGGAGGCATGGCGGCGCGCAAGGGCGTCATCATCAAGTCGGCCGAGTGCACGGAGCGG
GCGCGCAAGGTGACGGACGTGGTGTTTGACAAGACGGGCACCATTACCGAGGGCGAGCTGCAGGTGACGCACGAG
GAGCTGCTGGGGCCCGACGAGGAGGCCATTGTGGGTGTTGCGCGCTGTCTGGCGGCTGGCAACAAGCATCCCGTA
TCGCTGGCCGTGGCCAAGCATTTGCAGCAGCGCCGGGGGCCGCGCGTCAGGCTAAGCGACATGCAAGTGGTGCCG
GGCGCAGGCGTCGAGGCAGTCCATGGCAGCGACGTGTTTCGCGCCGGCAGCCCCTCGTGGACGGCCACGGCTGAT
CACGGCCTCATTGTGCGGCTGCAGGCCATGGGCCGTACGCTGCTCGTGGTGACGCGCAATGGCGAGCCCGTGGCC
GTCTTTGCCCTGCTGACGCGGGTGCGCGCCGAGGCTGCGGGCGTGGTGCACAGGCTGGTGCAGAGCGGCATCCGC
GTTCACTTGGTGTCGGGCGACCAAATGGGCGCCGTCATGACGGTGGCGGCCCAAGTCGGCATCTTCAACGTGGCT
GCCCAGTGCACGCCCTCGGACAAGCGCGACTACGTGGCCAGCCTCATGGCCACGCCGCGCCGCCCGCGCATCGTC
ATGTTTGTCGGCGACGGCACAAACGATGCTGTGGCGGTGACGCAGGCCGACGTGGGCGTCCAGCTGGCCAGCGTC
GTTTCCGCCAGCCACGTGACGCGCGGCGCCGCCGACGTGGTGCTGCTCAATGGCCTCGAGGGCGTCGTCTTGCTG
CTGCGCATCAGCGCCATTGCCTTTCGCCGCATGCTCTTCAACTTTGTCTGGTCCGCCGCCTACAATGTCCTGGCC
CTGCTCTTTGCCTCGGGCGCCCTGGTCAATGTCCGCATCCCCCCGGCCTATGCTGGCTTGGGCGAAATGTTTAGC
GTCTTGCCCGTCATTGGCGCCGCCGTGACGATGCTGTTTCAGAGGATCCGCACCAACGACGGCGCCGGCCTTTGC
ACTTGA
Transcript >OphauB2|4776
ATGGCTCAACGACTAGTCACAGGCACTGCCGGCCGCGGCAACACGCACAAGACCGAGTCCAACGGAGGGTCGACG
TGCAGCGCGCATCTCTCAAGGGCCTTTGAGCAGTACAGCGCCTACCTAGAGTCGGCCCGGCGAATTTGCCAAAAG
GTGCTCAGGCGTGCATGGCCGTCGAGACGCTGCGACGACAAGCCAGGACAAGCGGCTCGGCTCGACGGCGCTGAA
ATGAGTCGGACAGTTGACCAAGACCCCATTCAACATGACCATCATCATCATCATCACCACCACCATGGAGGCATC
AAGTGTCATGCAACTGGCGAACCCCCAACTCTCAACGCCATGAAGCCTCTAGCCCAGCTCAAGTCGGCCACAAGC
AAAAAGACTGGATGCTGCAGCACAGCCCACGCTAGAGAGCCCAAGGACGCGCATGCCGGCTGGGCCATGATGGAC
GGCAGCACGCGGACCGACGAGGTGGATCTCGAAAAAGCAAAGGGGCAGGAATGGATTGTGCTGAGCGTCACGGGC
ATGACGTGCTCGGGATGCGCCAACAAGATGGAGCGCACGCTGTGCTCCTTTGCGGGCGTCTCGTCGGTGCGGGTA
AACTTTGTCATGAGCTCGGCCGAGTTTAGACTCGACGACTCGTCGGCCGCGTCGCTGCAGCACATTATCCGTGGG
GTGGAAAAGGCAACGGGCTTTGGCTGCACGCGCGTGTCGACTAGGGAGCAGAGCATCGACGTGCTGGCCTCGGGC
GACTCGGCCAAGGCGCTGACCAAGCTGCCGCTGCCGGGGGTGACGCAGGTGACGGTGATTAGCAACAAGATTGTG
CGCATTGGGTATGATGCGAGGGTGGTGGGCGCCAGGGAGCTGGTTCAGAGGATCAGCTCGCTGTCGTGTGGGCTG
GCGCCGCCTGGCGACGACGCGAGCATTTGGCGCGGCCGACGGCGCCTCCACGACCAGCTCGTCTTGACCATGATT
GCCGGGGCCTTTACCCTGCCCATTGTCATCATGGCGTGGAGCGACAACTTGGTTGACCGGTATACCCAAGGCTGT
GTGTGCCTCGTCTTTGCCACCATTGTGCAGCTGGTGGCGGTGCCCGTCTTTTACCGTCCAGCAGTGGCGGCACTG
GTGCACAGTGGGTCGCTGGAAATGGACATGCTCATTGTCATTAGCATCACGGCGGCCTACACGTACTCGGTGGTG
GCGTTTGGCTTCCTCATGGTGGGCAAGAGCGTGGGCATGGAGTCGTTTTTCGAGACGAGCTCCTTGCTCATTACG
CTGGTGCTGCTGGGGCGGCTCATGGCTGCGTTTGCGCGGATGCGGGCGGTTGAAGCCGTGTCGCTGCGCTCGCTG
CAGTCCAACAAGGCCATTATTGTGCAGGGCGGGCGGGAGCAAGAGATTGATGCTCGGCTGCTGCAGTATGGCGAT
GTGGTGCGGGTTGAGCCGCACTCGACAGTGCCGACGGACGGCATTGTGACGGAGGGATGGAGCGAGGTGGACGAG
TCGATGCTGACGGGCGAGAGCGTGCCGGTGACGAAGCAGAGAGACGACACGGTGATTGCAGGCACGGTCAACGGG
TCGGGCGTCTTGACGGCACGGCTGACGCGTCTGCCGGGCAACAACACGGTGGCGGACATTGCGCAGCTGGTGGAG
GAGGCGGCCAACTCGAAGCCGCGGCTGCAGGACATTGCAGACGGGATTGCGGCGTGGTTTGTGCCCGTGGTGAGC
TGCATGGCCGTCATTGTGCTTGTGGTGTGGATGGTTGTGGGGGTGCGGGTGCGCGGCTACAGCGGCGGGCGGGCG
GTTTCCGTCGCCATCACGTATGCCGTTGCCACGCTGGCCGTGTCGTGTCCGTGTGCGCTGGGGCTGGCAGTGCCC
ATGGTGCTGGTGGTGGCGGGAGGCATGGCGGCGCGCAAGGGCGTCATCATCAAGTCGGCCGAGTGCACGGAGCGG
GCGCGCAAGGTGACGGACGTGGTGTTTGACAAGACGGGCACCATTACCGAGGGCGAGCTGCAGGTGACGCACGAG
GAGCTGCTGGGGCCCGACGAGGAGGCCATTGTGGGTGTTGCGCGCTGTCTGGCGGCTGGCAACAAGCATCCCGTA
TCGCTGGCCGTGGCCAAGCATTTGCAGCAGCGCCGGGGGCCGCGCGTCAGGCTAAGCGACATGCAAGTGGTGCCG
GGCGCAGGCGTCGAGGCAGTCCATGGCAGCGACGTGTTTCGCGCCGGCAGCCCCTCGTGGACGGCCACGGCTGAT
CACGGCCTCATTGTGCGGCTGCAGGCCATGGGCCGTACGCTGCTCGTGGTGACGCGCAATGGCGAGCCCGTGGCC
GTCTTTGCCCTGCTGACGCGGGTGCGCGCCGAGGCTGCGGGCGTGGTGCACAGGCTGGTGCAGAGCGGCATCCGC
GTTCACTTGGTGTCGGGCGACCAAATGGGCGCCGTCATGACGGTGGCGGCCCAAGTCGGCATCTTCAACGTGGCT
GCCCAGTGCACGCCCTCGGACAAGCGCGACTACGTGGCCAGCCTCATGGCCACGCCGCGCCGCCCGCGCATCGTC
ATGTTTGTCGGCGACGGCACAAACGATGCTGTGGCGGTGACGCAGGCCGACGTGGGCGTCCAGCTGGCCAGCGTC
GTTTCCGCCAGCCACGTGACGCGCGGCGCCGCCGACGTGGTGCTGCTCAATGGCCTCGAGGGCGTCGTCTTGCTG
CTGCGCATCAGCGCCATTGCCTTTCGCCGCATGCTCTTCAACTTTGTCTGGTCCGCCGCCTACAATGTCCTGGCC
CTGCTCTTTGCCTCGGGCGCCCTGGTCAATGTCCGCATCCCCCCGGCCTATGCTGGCTTGGGCGAAATGTTTAGC
GTCTTGCCCGTCATTGGCGCCGCCGTGACGATGCTGTTTCAGAGGATCCGCACCAACGACGGCGCCGGCCTTTGC
ACTTGA
Gene >OphauB2|4776
ATGGCTCAACGACTAGTCACAGGCACTGCCGGCCGCGGCAACACGCACAAGACCGAGTCCAACGGAGGGTCGACG
TGCAGCGCGCATCTCTCAAGGGCCTTTGAGCAGTACAGCGCCTACCTAGAGTCGGCCCGGCGAATTTGCCAAAAG
GTGCTCAGGCGTGCATGGCCGTCGAGACGCTGCGACGACAAGCCAGGACAAGCGGCTCGGCTCGACGGCGCTGAA
ATGAGTCGGACAGTTGACCAAGACCCCATTCAACATGACCATCATCATCATCATCACCACCACCATGGAGGCATC
AAGTGTCATGCAACTGGCGAACCCCCAACTCTCAACGCCATGAAGCCTCTAGCCCAGCTCAAGTCGGCCACAAGC
AAAAAGACTGGATGCTGCAGCACAGCCCACGCTAGAGAGCCCAAGGACGCGCATGCCGGCTGGGCCATGATGGAC
GGCAGCACGCGGACCGACGAGGTGGATCTCGAAAAAGCAAAGGGGCAGGAATGGATTGTGCTGAGCGTCACGGGC
ATGACGTGCTCGGGATGCGCCAACAAGATGGAGCGCACGCTGTGCTCCTTTGCGGGCGTCTCGTCGGTGCGGGTA
AACTTTGTCATGAGCTCGGCCGAGTTTAGACTCGACGACTCGTCGGCCGCGTCGCTGCAGCACATTATCCGTGGG
GTGGAAAAGGCAACGGGCTTTGGCTGCACGCGCGTGTCGACTAGGGAGCAGAGCATCGACGTGCTGGCCTCGGGC
GACTCGGCCAAGGCGCTGACCAAGCTGCCGCTGCCGGGGGTGACGCAGGTGACGGTGATTAGCAACAAGATTGTG
CGCATTGGGTATGATGCGAGGGTGGTGGGCGCCAGGGAGCTGGTTCAGAGGATCAGCTCGCTGTCGTGTGGGCTG
GCGCCGCCTGGCGACGACGCGAGCATTTGGCGCGGCCGACGGCGCCTCCACGACCAGCTCGTCTTGACCATGATT
GCCGGGGCCTTTACCCTGCCCATTGTCATCATGGCGTGGAGCGACAACTTGGTTGACCGGTATACCCAAGGCTGT
GTGTGCCTCGTCTTTGCCACCATTGTGCAGCTGGTGGCGGTGCCCGTCTTTTACCGTCCAGCAGTGGCGGCACTG
GTGCACAGTGGGTCGCTGGAAATGGACATGCTCATTGTCATTAGCATCACGGCGGCCTACACGTACTCGGTGGTG
GCGTTTGGCTTCCTCATGGTGGGCAAGAGCGTGGGCATGGAGTCGTTTTTCGAGACGAGCTCCTTGCTCATTACG
CTGGTGCTGCTGGGGCGGCTCATGGCTGCGTTTGCGCGGATGCGGGCGGTTGAAGCCGTGTCGCTGCGCTCGCTG
CAGTCCAACAAGGCCATTATTGTGCAGGGCGGGCGGGAGCAAGAGATTGATGCTCGGCTGCTGCAGTATGGCGAT
GTGGTGCGGGTTGAGCCGCACTCGACAGTGCCGACGGACGGCATTGTGACGGAGGGATGGAGCGAGGTGGACGAG
TCGATGCTGACGGGCGAGAGCGTGCCGGTGACGAAGCAGAGAGACGACACGGTGATTGCAGGCACGGTCAACGGG
TCGGGCGTCTTGACGGCACGGCTGACGCGTCTGCCGGGCAACAACACGGTGGCGGACATTGCGCAGCTGGTGGAG
GAGGCGGCCAACTCGAAGCCGCGGCTGCAGGACATTGCAGACGGGATTGCGGCGTGGTTTGTGCCCGTGGTGAGC
TGCATGGCCGTCATTGTGCTTGTGGTGTGGATGGTTGTGGGGGTGCGGGTGCGCGGCTACAGCGGCGGGCGGGCG
GTTTCCGTCGCCATCACGTATGCCGTTGCCACGCTGGCCGTGTCGTGTCCGTGTGCGCTGGGGCTGGCAGTGCCC
ATGGTGCTGGTGGTGGCGGGAGGCATGGCGGCGCGCAAGGGCGTCATCATCAAGTCGGCCGAGTGCACGGAGCGG
GCGCGCAAGGTGACGGACGTGGTGTTTGACAAGACGGGCACCATTACCGAGGGCGAGCTGCAGGTGACGCACGAG
GAGCTGCTGGGGCCCGACGAGGAGGCCATTGTGGGTGTTGCGCGCTGTCTGGCGGCTGGCAACAAGCATCCCGTA
TCGCTGGCCGTGGCCAAGCATTTGCAGCAGCGCCGGGGGCCGCGCGTCAGGCTAAGCGACATGCAAGTGGTGCCG
GGCGCAGGCGTCGAGGCAGTCCATGGCAGCGACGTGTTTCGCGCCGGCAGCCCCTCGTGGACGGCCACGGCTGAT
CACGGCCTCATTGTGCGGCTGCAGGCCATGGGCCGTACGCTGCTCGTGGTGACGCGCAATGGCGAGCCCGTGGCC
GTCTTTGCCCTGCTGACGCGGGTGCGCGCCGAGGCTGCGGGCGTGGTGCACAGGCTGGTGCAGAGCGGCATCCGC
GTTCACTTGGTGTCGGGCGACCAAATGGGCGCCGTCATGACGGTGGCGGCCCAAGTCGGCATCTTCAACGTGGCT
GCCCAGTGCACGCCCTCGGACAAGCGCGACTACGTGGCCAGCCTCATGGCCACGCCGCGCCGCCCGCGCATCGTC
ATGTTTGTCGGCGACGGCACAAACGATGCTGTGGCGGTGACGCAGGCCGACGTGGGCGTCCAGCTGGCCAGCGTC
GTTTCCGCCAGCCACGTGACGCGCGGCGCCGCCGACGTGGTGCTGCTCAATGGCCTCGAGGGCGTCGTCTTGCTG
CTGCGCATCAGCGCCATTGCCTTTCGCCGCATGCTCTTCAACTTTGTCTGGTCCGCCGCCTACAATGTCCTGGCC
CTGCTCTTTGCCTCGGGCGCCCTGGTCAATGTCCGCATCCCCCCGGCCTATGCTGGCTTGGGCGAAATGTTTAGC
GTCTTGCCCGTCATTGGCGCCGCCGTGACGATGCTGTTTCAGAGGATCCGCACCAACGACGGCGCCGGCCTTTGC
ACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail