Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4769
Gene name
LocationContig_33:50873..51826
Strand+
Gene length (bp)953
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07264 EI24 Etoposide-induced protein 2.4 (EI24) 7.4E-08 29 242

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 50 71 21
3 78 100 22
4 167 189 22
5 222 244 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4769
MERDAAARKRCSVWSASLLGRGAIAASYPLRGIWFFVRNRDFWPLFLGRLLPLSVISLIVYLVLFIFAFLPQFAF
IAIFHGWGAWINAVVLTLGEGLVIIQGLFEGFFVDECRVDIFDATLIKLGFKDLIAPHRLLFDDAPNAVKMLGKP
TSPAAYQPWSVIQIVELIVFLPLNLIPIVGTPAFIIITGTRIGKLSQYRWYELRGLSKSERKREIRSRTWEYIWF
GTVAMILELVPILSFFFLLTTTAGSAMWAAEMERKLRLARDAANAPLAPEPQSVHEAGTSSPPPPYSDHDAA*
Coding >OphauB2|4769
ATGGAACGCGACGCCGCAGCACGCAAACGCTGCTCTGTGTGGTCTGCGTCGCTTCTTGGGCGCGGCGCCATTGCT
GCTTCATACCCTCTTCGCGGCATCTGGTTCTTTGTGCGCAACCGAGACTTTTGGCCCCTATTCTTGGGAAGACTG
CTTCCCTTGTCCGTCATATCCCTCATAGTCTACCTAGTCCTCTTCATCTTTGCCTTTTTGCCCCAATTTGCCTTT
ATAGCAATCTTTCACGGCTGGGGGGCTTGGATCAATGCCGTGGTTTTGACGCTGGGCGAGGGTCTCGTCATTATT
CAGGGCCTCTTTGAGGGCTTTTTTGTTGATGAATGTCGGGTCGATATTTTTGATGCTACCCTCATCAAGCTCGGC
TTCAAGGACCTCATTGCGCCCCATCGCCTCCTCTTTGACGATGCGCCGAATGCTGTCAAGATGCTGGGAAAGCCT
ACAAGCCCTGCTGCCTATCAACCCTGGAGCGTGATTCAAATCGTTGAGCTCATTGTTTTTCTACCCCTCAATCTT
ATTCCTATTGTCGGCACCCCAGCCTTTATAATCATTACCGGGACTCGGATTGGCAAGCTGTCGCAGTACCGCTGG
TATGAACTGCGCGGACTGTCCAAGTCGGAGCGCAAGCGCGAGATTCGGAGCAGGACGTGGGAGTATATTTGGTTT
GGCACCGTGGCCATGATTCTAGAGCTAGTTCCCATCTTGTCCTTTTTCTTCTTGCTTACCACTACTGCGGGCTCA
GCCATGTGGGCTGCTGAGATGGAGCGCAAGTTGCGCCTGGCGCGCGATGCTGCCAATGCTCCACTTGCTCCAGAG
CCCCAGAGTGTGCATGAGGCAGGGACATCGTCGCCGCCGCCGCCGTATTCGGATCATGACGCGGCATGA
Transcript >OphauB2|4769
ATGGAACGCGACGCCGCAGCACGCAAACGCTGCTCTGTGTGGTCTGCGTCGCTTCTTGGGCGCGGCGCCATTGCT
GCTTCATACCCTCTTCGCGGCATCTGGTTCTTTGTGCGCAACCGAGACTTTTGGCCCCTATTCTTGGGAAGACTG
CTTCCCTTGTCCGTCATATCCCTCATAGTCTACCTAGTCCTCTTCATCTTTGCCTTTTTGCCCCAATTTGCCTTT
ATAGCAATCTTTCACGGCTGGGGGGCTTGGATCAATGCCGTGGTTTTGACGCTGGGCGAGGGTCTCGTCATTATT
CAGGGCCTCTTTGAGGGCTTTTTTGTTGATGAATGTCGGGTCGATATTTTTGATGCTACCCTCATCAAGCTCGGC
TTCAAGGACCTCATTGCGCCCCATCGCCTCCTCTTTGACGATGCGCCGAATGCTGTCAAGATGCTGGGAAAGCCT
ACAAGCCCTGCTGCCTATCAACCCTGGAGCGTGATTCAAATCGTTGAGCTCATTGTTTTTCTACCCCTCAATCTT
ATTCCTATTGTCGGCACCCCAGCCTTTATAATCATTACCGGGACTCGGATTGGCAAGCTGTCGCAGTACCGCTGG
TATGAACTGCGCGGACTGTCCAAGTCGGAGCGCAAGCGCGAGATTCGGAGCAGGACGTGGGAGTATATTTGGTTT
GGCACCGTGGCCATGATTCTAGAGCTAGTTCCCATCTTGTCCTTTTTCTTCTTGCTTACCACTACTGCGGGCTCA
GCCATGTGGGCTGCTGAGATGGAGCGCAAGTTGCGCCTGGCGCGCGATGCTGCCAATGCTCCACTTGCTCCAGAG
CCCCAGAGTGTGCATGAGGCAGGGACATCGTCGCCGCCGCCGCCGTATTCGGATCATGACGCGGCATGA
Gene >OphauB2|4769
ATGGAACGCGACGCCGCAGCACGCAAACGCTGCTCTGTGTGGTCTGCGTCGCTTCTTGGGCGCGGCGCCATTGCT
GCTTCATACCCTCTTCGCGGCATCTGGTTCTTTGTGCGCAACCGAGACTTTTGGCCCCTATTCTTGGGAAGACTG
CTTCCCTTGTCCGTCATATCCCTCATAGTCTACCTAGTCCTCTTCATCTTTGCCTTTTTGCCCCAATTTGCCTTT
ATAGCAATCTTTCACGGCTGGGGGGCTTGGATCAATGCCGTGGTTTTGACGCTGGGCGAGGGTCTCGTCATTATT
CAGGGCCTCTTTGAGGGCTTTTTTGTTGATGAATGTCGGGTCGATATTTTTGATGTAGGTGTTTTTTTTTGAACT
CTGGCTTTGCGAAAGAGACACGGCTGACCTGGGTTCAGGCTACCCTCATCAAGCTCGGCTTCAAGGACCTCATTG
CGCCCCATCGCCTCCTCTTTGACGATGCGCCGAATGCTGTCAAGATGCTGGGAAAGCCTACAAGCCCTGCTGCCT
ATCAACCCTGGAGCGTGATTCAAATCGTTGAGCTCATTGTTTTTCTACCCCTCAATCTTATTCCTATTGTCGGCA
CCCCAGCCTTTATAATCATTACCGGGACTCGGATTGGCAAGCTGTCGCAGTACCGCTGGTATGAACTGCGCGGAC
TGTCCAAGTCGGAGCGCAAGCGCGAGATTCGGAGCAGGACGTGGGAGTATATTTGGTTTGGCACCGTGGCCATGA
TTCTAGAGCTAGTTCCCATCTTGTCCTTTTTCTTCTTGCTTACCACTACTGCGGGCTCAGCCATGTGGGCTGCTG
AGATGGAGCGCAAGTTGCGCCTGGCGCGCGATGCTGCCAATGCTCCACTTGCTCCAGAGCCCCAGAGTGTGCATG
AGGCAGGGACATCGTCGCCGCCGCCGCCGTATTCGGATCATGACGCGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail